close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

The Crucible of Flame

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-06-23 Correct Ancient Flame base damage.
Ancient Flame (effect#3) coefficient 1.23 2.28

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second63,362 (6.34%)61,808 (3.73%)61,740 (3.62%)61,591 (3.37%)61,576 (3.34%)61,343 (2.95%)60,856 (2.14%)60,789 (2.02%)60,768 (1.99%)59,621 (0.06%)59,584worldveinpurification protocolfocusing irislucid dreamsblood of the enemyunbound forcecrucible of flamevisionslife-forcebaseripple in spacefocusing iris Damage per Second: 61,740.0
Created with Highcharts 4.2.3 Priority Target/Boss Damage 39,513 (5.87%)38,849 (4.09%)38,585 (3.39%)38,541 (3.27%)38,423 (2.95%)38,264 (2.53%)38,066 (1.99%)37,869 (1.47%)37,819 (1.33%)37,348 (0.07%)37,321worldveinlucid dreamsfocusing irisblood of the enemyunbound forcevisionspurification protocollife-forcecrucible of flamebaseripple in spaceblood of the enemy Priority Target/Boss Damage : 38,541.0

Actions per Minute / DPS Variance Summary

base : 59621 dps, 37348 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
59621.0 59621.0 57.6 / 0.097% 6168.8 / 10.3% 7429.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 7.9 Astral Power 0.00% 57.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 59621
Fury of Elune 2591 4.3% 5.3 60.75sec 144777 142961 Direct 388.6 1681 3354 1990 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 388.60 142.32 0.00 1.0128 0.2960 773421.27 773421.27 0.00 16268.17 142961.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 316.75 81.51% 1680.95 1457 1987 1682.65 1557 1829 532436 532436 0.00
crit 71.84 18.49% 3354.46 2915 3974 3358.03 3098 3859 240985 240985 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 298 (681) 0.5% (1.1%) 8.2 33.18sec 24763 0 Direct 8.2 9130 18260 10835 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 89122.81 89122.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.34% 9129.54 8921 9813 9129.10 8921 9813 61085 61085 0.00
crit 1.54 18.66% 18260.31 17842 19626 14181.36 0 19626 28038 28038 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 383 0.6% 8.2 33.18sec 13929 0 Direct 24.7 3913 7823 4643 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 24.68 0.00 0.00 0.0000 0.0000 114589.54 114589.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.07 81.33% 3912.93 3823 4206 3912.44 3823 4206 78534 78534 0.00
crit 4.61 18.67% 7823.46 7646 8411 7707.59 0 8411 36055 36055 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 9973 16.7% 84.8 3.49sec 35186 26318 Direct 254.5 9898 19703 11729 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.83 254.49 0.00 0.00 1.3370 0.0000 2984749.67 2984749.67 0.00 26317.53 26317.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 206.97 81.33% 9897.97 3345 24211 9904.46 9109 11222 2048551 2048551 0.00
crit 47.51 18.67% 19702.96 6689 48422 19713.14 13981 25464 936198 936198 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9553 16.0% 27.3 10.90sec 104615 101064 Direct 54.6 3527 7050 4186 18.7%  
Periodic 666.5 3324 6644 3944 18.7% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.31 54.63 666.50 666.50 1.0352 1.3329 2857375.80 2857375.80 0.00 3117.07 101063.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.41 81.31% 3527.11 3280 4472 3528.32 3365 3736 156654 156654 0.00
crit 10.21 18.69% 7050.27 6559 8943 7054.68 6559 8161 72001 72001 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 542.0 81.33% 3324.11 6 4163 3325.74 3237 3463 1801813 1801813 0.00
crit 124.5 18.67% 6644.11 5 8327 6646.98 6346 7108 826908 826908 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2793 (8609) 4.7% (14.4%) 79.6 3.68sec 32366 37091 Direct 80.2 8770 17554 10414 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.57 80.19 0.00 0.00 0.8726 0.0000 835042.85 835042.85 0.00 37091.45 37091.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.18 81.29% 8770.47 7949 10838 8775.61 8450 9184 571697 571697 0.00
crit 15.00 18.71% 17553.57 15898 21676 17565.22 16081 19534 263346 263346 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 5816 9.8% 74.6 3.90sec 23336 0 Direct 223.7 7779 0 7779 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.57 223.71 0.00 0.00 0.0000 0.0000 1740179.11 1740179.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.71 100.00% 7778.76 5962 16257 7782.29 6830 9115 1740179 1740179 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13369 22.4% 60.0 5.01sec 66664 63965 Direct 59.8 56275 112449 66887 18.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.97 59.77 0.00 0.00 1.0422 0.0000 3997992.43 3997992.43 0.00 63964.81 63964.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.48 81.10% 56275.14 51347 69612 56302.78 54394 59634 2727976 2727976 0.00
crit 11.29 18.90% 112449.10 102695 139223 112490.59 102695 139223 1270017 1270017 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5890 9.8% 90.1 3.08sec 19438 0 Direct 90.1 16394 32796 19439 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.10 90.10 0.00 0.00 0.0000 0.0000 1751425.68 1751425.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.38 81.44% 16393.68 16021 17623 16393.63 16021 17196 1202914 1202914 0.00
crit 16.72 18.56% 32796.20 32042 35246 32795.28 32042 35246 548512 548512 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 8955 15.0% 18.1 16.71sec 147638 145490 Direct 18.1 4506 9018 5332 18.3%  
Periodic 669.9 3246 6489 3853 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.14 18.14 669.87 669.87 1.0148 1.3322 2678030.64 2678030.64 0.00 2940.19 145489.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.82 81.69% 4505.57 4112 5607 4505.87 4225 4891 66761 66761 0.00
crit 3.32 18.31% 9018.01 8225 11214 8743.34 0 11214 29956 29956 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 544.4 81.27% 3246.24 2 4065 3247.78 3170 3374 1767356 1767356 0.00
crit 125.4 18.73% 6488.81 56 8130 6491.75 6254 6824 813958 813958 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.29sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.14sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8970 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 52.7 45.0sec 5.0sec 93.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.42%
  • arcanic_pulsar_2:11.13%
  • arcanic_pulsar_3:11.43%
  • arcanic_pulsar_4:9.50%
  • arcanic_pulsar_5:13.90%
  • arcanic_pulsar_6:11.43%
  • arcanic_pulsar_7:9.53%
  • arcanic_pulsar_8:15.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.3sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.3sec 182.3sec 8.12% 7.94% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.72% 34.08% 0.0(0.0) 8.0

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.7sec 45.4sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.08% 0.00% 84.2(84.2) 5.2

Buff details

  • buff initial source:base
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.15% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.7 42.5 9.0sec 3.9sec 78.93% 86.11% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.62%
  • lunar_empowerment_2:27.93%
  • lunar_empowerment_3:14.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.0sec 33.6sec 48.07% 0.00% 3.5(49.1) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.1 50.0 10.9sec 3.9sec 84.77% 92.97% 0.2(0.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.41%
  • solar_empowerment_2:38.58%
  • solar_empowerment_3:15.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 44.8 20.4sec 5.0sec 97.12% 92.42% 15.0(15.0) 12.1

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.23%
  • starlord_2:21.75%
  • starlord_3:59.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.4 1.2 60.3sec 45.3sec 23.96% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 60.0 2398.9 40.0 40.0 1666.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 80.57 644.22 (27.27%) 8.00 0.33 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.39%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.23 210.52 (8.91%) 2.50 0.06 0.03%
sunfire Astral Power 18.14 54.42 (2.30%) 3.00 0.00 0.00%
moonfire Astral Power 27.31 81.94 (3.47%) 3.00 0.00 0.00%
lunar_strike Astral Power 84.83 1017.51 (43.07%) 11.99 0.45 0.04%
natures_balance Astral Power 399.85 199.91 (8.46%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.16 73.95 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.89 8.01
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.37 0.00 67.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data base Damage Per Second
Count 2990
Mean 59620.99
Minimum 54600.30
Maximum 64927.57
Spread ( max - min ) 10327.26
Range [ ( max - min ) / 2 * 100% ] 8.66%
Standard Deviation 1606.4370
5th Percentile 57085.55
95th Percentile 62357.08
( 95th Percentile - 5th Percentile ) 5271.52
Mean Distribution
Standard Deviation 29.3784
95.00% Confidence Intervall ( 59563.41 - 59678.57 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2789
0.1 Scale Factor Error with Delta=300 22030
0.05 Scale Factor Error with Delta=300 88120
0.01 Scale Factor Error with Delta=300 2202983
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 2990
Mean 37347.67
Minimum 33733.75
Maximum 41150.24
Spread ( max - min ) 7416.49
Range [ ( max - min ) / 2 * 100% ] 9.93%
Standard Deviation 1183.1232
5th Percentile 35475.93
95th Percentile 39395.25
( 95th Percentile - 5th Percentile ) 3919.32
Mean Distribution
Standard Deviation 21.6369
95.00% Confidence Intervall ( 37305.26 - 37390.08 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3856
0.1 Scale Factor Error with Delta=300 11950
0.05 Scale Factor Error with Delta=300 47798
0.01 Scale Factor Error with Delta=300 1194934
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 2990
Mean 59620.99
Minimum 54600.30
Maximum 64927.57
Spread ( max - min ) 10327.26
Range [ ( max - min ) / 2 * 100% ] 8.66%
Damage
Sample Data base Damage
Count 2990
Mean 17821929.80
Minimum 14079496.96
Maximum 21719240.87
Spread ( max - min ) 7639743.90
Range [ ( max - min ) / 2 * 100% ] 21.43%
DTPS
Sample Data base Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.11 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.97 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.00 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.84 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.61 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.47 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 85.22 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 79.78 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.52 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQPKQPKQNQPQPOQOKQPKQPKPPPQPPNKQKQPQPQMKOPKPPQKNQPKQPPQQPKOOKIPNPKQPQQPPJKQKQKQPNOOKPPPQQPPKKPNPOKOQPQPKQPPQKNQPGQIKQKQPQKMOPPPNKQPKQPQKQOPQPKQNOPQKQPPKQPPOKNQPQPLOQKPHEFKIQKQPQPKOQPKNQPQPJKQKOPKPQPPQQPNOQJKQKQPKLOPKPPQPPQPQKKOPGNQIPOQKQPKQPQPJKQKNQPQKQMPKOPPPQQPKKNPPQKQOPQKOPQNQKPQQPI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.238 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:03.090 default O moonfire enemy3 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.014 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.194 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
0:05.948 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
0:05.948 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
0:05.948 default I fury_of_elune Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:06.703 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.458 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.213 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.968 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.724 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:10.512 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.266 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.020 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.786 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.541 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.295 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.049 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.803 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.557 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.314 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.068 default O moonfire enemy2 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.823 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.579 default O moonfire enemy3 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.335 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.089 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.843 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.692 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.448 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.203 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.009 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.765 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.665 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
0:27.768 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers
0:28.873 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, conch_of_dark_whispers
0:29.625 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:30.935 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:32.246 default N sunfire Fluffy_Pillow 89.0/100: 89% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:33.123 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:33.998 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
0:34.754 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:35.516 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
0:36.271 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
0:37.240 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:37.995 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
0:38.963 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:39.725 default M moonfire Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:40.487 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2)
0:41.440 default O moonfire enemy2 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
0:42.642 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
0:44.172 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:45.375 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:46.863 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:48.353 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2)
0:49.347 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:50.516 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:51.652 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:52.619 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
0:53.944 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
0:54.986 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
0:55.876 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
0:57.214 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
0:58.561 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:59.463 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(18)
1:00.368 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(17)
1:01.970 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(5), overwhelming_power(16)
1:03.140 default O moonfire enemy2 34.0/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14)
1:04.283 default O moonfire enemy3 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
1:05.430 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12)
1:06.581 default I fury_of_elune Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
1:07.704 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
1:09.139 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8)
1:10.273 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
1:11.724 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6)
1:12.867 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5)
1:13.816 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4)
1:15.241 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
1:16.201 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power
1:17.163 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:18.864 default P lunar_strike Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:20.566 default J cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:20.566 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), torrent_of_elements
1:21.804 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:22.694 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements
1:23.740 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
1:24.530 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
1:25.465 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
1:26.240 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:27.393 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:28.436 default O moonfire enemy3 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:29.484 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:30.533 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
1:31.588 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
1:32.935 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
1:34.287 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
1:35.648 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
1:36.559 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
1:37.474 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
1:39.092 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(12)
1:40.721 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(3), overwhelming_power(11)
1:41.909 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10)
1:43.070 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8)
1:44.515 default N sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
1:45.652 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6)
1:47.108 default O moonfire enemy3 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(4)
1:48.261 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(3)
1:49.414 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(2)
1:50.544 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power
1:51.506 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:52.952 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3)
1:53.918 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:55.366 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
1:56.502 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
1:57.468 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:58.915 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
2:00.364 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3)
2:01.329 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2)
2:02.567 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord
2:03.769 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord
2:04.792 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord
2:06.323 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord
2:06.323 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, ignition_mages_fuse
2:07.302 default I fury_of_elune Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord, ignition_mages_fuse
2:08.454 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord, ignition_mages_fuse
2:09.607 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
2:10.433 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(2)
2:11.368 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:12.142 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:13.299 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:14.069 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:14.978 default M moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:15.852 default O moonfire enemy3 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:16.854 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:18.133 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:19.409 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:20.639 default N sunfire Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:21.607 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), solar_empowerment(2), ignition_mages_fuse(4)
2:22.659 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, ignition_mages_fuse(5)
2:23.496 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse(5)
2:24.752 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, ignition_mages_fuse(5)
2:25.737 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), ignition_mages_fuse(5)
2:26.551 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:28.039 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2)
2:29.033 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:30.201 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:31.167 default O moonfire enemy2 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:32.303 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:33.751 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:34.719 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:36.168 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:37.305 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:38.273 default N sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:39.408 default O moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:40.545 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:41.993 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment(3), torrent_of_elements, conch_of_dark_whispers
2:43.046 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), torrent_of_elements, conch_of_dark_whispers
2:44.284 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, conch_of_dark_whispers
2:45.308 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:46.840 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:48.371 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord
2:49.573 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2)
2:50.567 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:52.056 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:53.545 default O moonfire enemy3 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
2:54.713 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
2:55.882 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24)
2:56.789 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
2:57.564 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
2:58.727 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(21)
2:59.507 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20)
3:00.678 default L sunfire Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(19)
3:01.602 default O moonfire enemy2 66.0/100: 66% astral_power solar_empowerment, starlord(3), overwhelming_power(18)
3:02.667 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power solar_empowerment, starlord(3), overwhelming_power(17)
3:03.575 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power lunar_empowerment, overwhelming_power(16)
3:04.743 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(15)
3:06.194 default H celestial_alignment Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), conch_of_dark_whispers
3:07.191 default E potion Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), conch_of_dark_whispers
3:07.191 default F berserking Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:07.191 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:08.102 default I fury_of_elune Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:08.990 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:09.746 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
3:10.638 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect
3:11.392 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:12.505 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:13.259 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:14.379 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:15.204 default O moonfire enemy3 61.0/100: 61% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:16.031 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:16.786 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:17.844 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:18.678 default N sunfire Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:19.517 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:20.305 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:21.482 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:22.272 default P lunar_strike Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:23.460 default J cancel_buff Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:23.460 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(15), battle_potion_of_intellect
3:24.482 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14), battle_potion_of_intellect
3:25.328 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(25), battle_potion_of_intellect
3:26.283 default O moonfire enemy2 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24), battle_potion_of_intellect
3:27.355 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), battle_potion_of_intellect
3:28.725 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), battle_potion_of_intellect
3:29.805 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect
3:31.147 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:32.049 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:33.405 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
3:34.767 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(16)
3:35.677 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(15)
3:36.591 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14)
3:38.211 default N sunfire Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12)
3:39.297 default O moonfire enemy3 86.0/100: 86% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(24)
3:40.340 default Q solar_wrath Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(23)
3:41.388 default J cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22)
3:41.388 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), overwhelming_power(22)
3:42.533 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21)
3:43.357 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(20)
3:44.331 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19)
3:45.140 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(18)
3:46.352 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(17)
3:47.307 default L sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16)
3:48.240 default O moonfire enemy2 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15)
3:49.317 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14)
3:50.692 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13)
3:51.774 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12)
3:53.160 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
3:54.556 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9)
3:55.490 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
3:56.896 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
3:58.307 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(23)
3:59.197 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22)
4:00.533 default Q solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(21)
4:01.430 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(3), overwhelming_power(20)
4:02.583 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19)
4:03.706 default O moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
4:04.801 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
4:06.200 default G use_items Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(15)
4:06.200 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(15), ignition_mages_fuse
4:07.263 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(14), ignition_mages_fuse
4:08.168 default I fury_of_elune Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), ignition_mages_fuse
4:09.238 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), ignition_mages_fuse
4:10.605 default O moonfire enemy3 68.0/100: 68% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(11), ignition_mages_fuse(2)
4:11.639 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(10), ignition_mages_fuse(2)
4:12.522 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), ignition_mages_fuse(2)
4:13.562 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), ignition_mages_fuse(2)
4:14.427 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), ignition_mages_fuse(3)
4:15.676 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), ignition_mages_fuse(3)
4:16.660 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), ignition_mages_fuse(3)
4:17.500 default P lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(3)
4:18.761 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), ignition_mages_fuse(4)
4:19.575 default P lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), ignition_mages_fuse(4)
4:20.799 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power, ignition_mages_fuse(4)
4:20.799 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(7), solar_empowerment(2), overwhelming_power, ignition_mages_fuse(4)
4:21.851 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, ignition_mages_fuse(4)
4:22.721 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(5)
4:23.707 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
4:24.539 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
4:25.292 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
4:26.351 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:27.217 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
4:28.233 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:29.074 default M moonfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
4:30.064 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
4:31.512 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
4:32.648 default O moonfire enemy3 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:33.784 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:35.233 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
4:36.681 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:38.128 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
4:39.095 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
4:40.062 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(2), starlord(3)
4:41.765 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(2)
4:43.004 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord
4:44.207 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:45.375 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:46.863 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:48.352 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), conch_of_dark_whispers
4:49.344 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:50.513 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:51.478 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:52.614 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:54.062 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:55.030 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
4:56.166 default O moonfire enemy2 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:57.304 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:58.750 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:59.715 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
5:00.851 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
5:01.817 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6)
5:03.056 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
5:04.588 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord
5:05.610 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment, starlord
5:06.633 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, starlord
5:08.163 default I fury_of_elune Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), starlord

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

blood of the enemy : 61576 dps, 38541 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
61575.7 61575.7 59.2 / 0.096% 6249.1 / 10.1% 7576.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 61576
Fury of Elune 2704 4.4% 5.3 60.81sec 151296 152895 Direct 396.8 1688 3372 2035 20.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 396.79 145.13 0.00 0.9896 0.2902 807436.85 807436.85 0.00 17037.41 152894.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 314.95 79.38% 1687.57 1457 1987 1688.88 1594 1832 531502 531502 0.00
crit 81.84 20.62% 3371.78 2915 3974 3374.23 3170 3717 275935 275935 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 308 (704) 0.5% (1.1%) 8.3 32.36sec 25253 0 Direct 8.3 9124 18255 11039 21.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.34 8.34 0.00 0.00 0.0000 0.0000 92114.13 92114.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.59 79.01% 9123.89 8921 9813 9117.43 0 9813 60146 60146 0.00
crit 1.75 20.99% 18255.23 17842 19626 15246.43 0 19626 31968 31968 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 396 0.6% 8.3 32.36sec 14212 0 Direct 25.0 3911 7821 4738 21.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.34 25.03 0.00 0.00 0.0000 0.0000 118579.75 118579.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.74 78.85% 3910.65 3823 4206 3910.62 3823 4176 77184 77184 0.00
crit 5.29 21.15% 7820.58 7646 8411 7722.88 0 8411 41396 41396 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 10313 16.8% 86.3 3.43sec 35760 27133 Direct 258.9 9870 19737 11919 20.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.30 258.91 0.00 0.00 1.3180 0.0000 3086219.36 3086219.36 0.00 27132.79 27132.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 205.13 79.23% 9869.94 3345 24211 9876.57 8861 10924 2024594 2024594 0.00
crit 53.78 20.77% 19736.61 6689 48422 19754.62 13818 25877 1061625 1061625 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9870 16.0% 27.4 10.88sec 107870 105574 Direct 54.7 3524 7053 4252 20.6%  
Periodic 676.9 3324 6645 4017 20.9% 296.7%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.37 54.73 676.89 676.89 1.0218 1.3126 2952072.44 2952072.44 0.00 3221.20 105574.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.45 79.39% 3524.07 3280 4472 3525.06 3353 3733 153125 153125 0.00
crit 11.28 20.61% 7052.65 6559 8943 7054.63 6559 8007 79571 79571 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 535.5 79.12% 3323.79 2 4163 3325.30 3244 3453 1780023 1780023 0.00
crit 141.4 20.88% 6645.28 63 8327 6648.22 6420 7001 939353 939353 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2893 (8907) 4.7% (14.5%) 81.0 3.61sec 32902 38143 Direct 81.6 8768 17556 10603 20.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.99 81.60 0.00 0.00 0.8626 0.0000 865181.04 865181.04 0.00 38142.82 38142.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.56 79.12% 8767.73 7949 10838 8772.46 8483 9199 566067 566067 0.00
crit 17.04 20.88% 17556.27 15898 21676 17569.43 16163 19486 299114 299114 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 6014 9.8% 75.7 3.84sec 23758 0 Direct 227.2 7919 0 7919 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.74 227.23 0.00 0.00 0.0000 0.0000 1799514.72 1799514.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 227.23 100.00% 7919.22 5962 16257 7922.14 6970 9162 1799515 1799515 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13729 22.3% 60.7 4.95sec 67585 65743 Direct 60.5 56270 112400 67831 20.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.74 60.52 0.00 0.00 1.0280 0.0000 4104968.50 4104968.50 0.00 65742.61 65742.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.06 79.41% 56269.67 51347 69612 56296.20 54496 58882 2704208 2704208 0.00
crit 12.46 20.59% 112399.76 102695 139223 112418.49 102695 123970 1400760 1400760 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6099 9.9% 91.6 3.03sec 19790 0 Direct 91.6 16389 32780 19791 20.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.65 91.65 0.00 0.00 0.0000 0.0000 1813744.59 1813744.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.63 79.25% 16388.83 16021 17623 16389.11 16021 17186 1190343 1190343 0.00
crit 19.02 20.75% 32779.61 32042 35246 32779.10 32042 34712 623401 623401 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 9250 15.0% 18.1 16.80sec 152855 152375 Direct 18.1 4507 9012 5429 20.5%  
Periodic 680.3 3246 6489 3922 20.9% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.10 18.10 680.29 680.29 1.0032 1.3119 2766517.84 2766517.84 0.00 3038.09 152374.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.39 79.53% 4506.88 4112 5607 4508.05 4249 4853 64870 64870 0.00
crit 3.71 20.47% 9012.21 8225 11214 8881.69 0 11214 33397 33397 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 538.4 79.14% 3245.73 9 4065 3247.15 3165 3380 1747506 1747506 0.00
crit 141.9 20.86% 6488.85 8 8130 6491.89 6266 6890 920745 920745 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.83sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.79sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8980 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.4 44.5sec 5.0sec 93.57% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.96%
  • arcanic_pulsar_2:11.14%
  • arcanic_pulsar_3:11.17%
  • arcanic_pulsar_4:9.49%
  • arcanic_pulsar_5:13.76%
  • arcanic_pulsar_6:11.80%
  • arcanic_pulsar_7:9.74%
  • arcanic_pulsar_8:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.9sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.8sec 182.8sec 8.12% 7.78% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 8.0 0.0 37.2sec 37.2sec 20.98% 0.00% 0.0(0.0) 7.7

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:631.87

Stack Uptimes

  • bloodsoaked_1:20.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 6.8 307.9 46.0sec 0.9sec 82.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.69

Stack Uptimes

  • bloodsoaked_counter_1:2.13%
  • bloodsoaked_counter_2:2.13%
  • bloodsoaked_counter_3:2.02%
  • bloodsoaked_counter_4:1.95%
  • bloodsoaked_counter_5:1.89%
  • bloodsoaked_counter_6:1.83%
  • bloodsoaked_counter_7:1.76%
  • bloodsoaked_counter_8:1.73%
  • bloodsoaked_counter_9:1.72%
  • bloodsoaked_counter_10:7.44%
  • bloodsoaked_counter_11:2.15%
  • bloodsoaked_counter_12:2.22%
  • bloodsoaked_counter_13:2.16%
  • bloodsoaked_counter_14:2.15%
  • bloodsoaked_counter_15:2.12%
  • bloodsoaked_counter_16:2.10%
  • bloodsoaked_counter_17:2.10%
  • bloodsoaked_counter_18:2.06%
  • bloodsoaked_counter_19:2.09%
  • bloodsoaked_counter_20:2.05%
  • bloodsoaked_counter_21:2.03%
  • bloodsoaked_counter_22:2.04%
  • bloodsoaked_counter_23:1.99%
  • bloodsoaked_counter_24:1.98%
  • bloodsoaked_counter_25:1.96%
  • bloodsoaked_counter_26:1.97%
  • bloodsoaked_counter_27:1.95%
  • bloodsoaked_counter_28:1.92%
  • bloodsoaked_counter_29:1.94%
  • bloodsoaked_counter_30:1.91%
  • bloodsoaked_counter_31:1.91%
  • bloodsoaked_counter_32:1.89%
  • bloodsoaked_counter_33:1.87%
  • bloodsoaked_counter_34:1.85%
  • bloodsoaked_counter_35:1.83%
  • bloodsoaked_counter_36:1.83%
  • bloodsoaked_counter_37:1.79%
  • bloodsoaked_counter_38:1.80%
  • bloodsoaked_counter_39:1.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.4sec 37.4sec 25.83% 33.70% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.7sec 45.2sec 23.89% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.07% 0.00% 84.2(84.2) 5.2

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.6 42.6 8.8sec 3.9sec 78.76% 85.85% 1.8(1.8) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.90%
  • lunar_empowerment_2:27.91%
  • lunar_empowerment_3:13.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 64.3sec 33.4sec 48.71% 0.00% 3.6(50.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.39%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.47%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.74%
  • overwhelming_power_10:1.79%
  • overwhelming_power_11:1.84%
  • overwhelming_power_12:1.90%
  • overwhelming_power_13:1.95%
  • overwhelming_power_14:2.01%
  • overwhelming_power_15:2.07%
  • overwhelming_power_16:2.13%
  • overwhelming_power_17:2.20%
  • overwhelming_power_18:2.26%
  • overwhelming_power_19:2.34%
  • overwhelming_power_20:2.41%
  • overwhelming_power_21:2.48%
  • overwhelming_power_22:2.56%
  • overwhelming_power_23:2.64%
  • overwhelming_power_24:2.72%
  • overwhelming_power_25:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 28.2 50.0 10.5sec 3.8sec 84.36% 92.80% 0.2(0.2) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.94%
  • solar_empowerment_2:38.05%
  • solar_empowerment_3:15.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.5 20.4sec 4.9sec 97.30% 92.95% 15.6(15.6) 12.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.39%
  • starlord_2:21.64%
  • starlord_3:59.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.7sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.56%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 60.7 2429.5 40.0 40.0 1689.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 81.99 655.61 (27.40%) 8.00 0.31 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.34%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.19 210.46 (8.80%) 2.50 0.02 0.01%
sunfire Astral Power 18.10 54.30 (2.27%) 3.00 0.00 0.00%
moonfire Astral Power 27.37 82.10 (3.43%) 3.00 0.00 0.00%
lunar_strike Astral Power 86.31 1035.32 (43.28%) 12.00 0.36 0.03%
natures_balance Astral Power 399.85 199.91 (8.36%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.22 74.62 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.99 8.11
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.45 0.00 57.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data blood of the enemy Damage Per Second
Count 2990
Mean 61575.65
Minimum 56723.25
Maximum 67289.14
Spread ( max - min ) 10565.89
Range [ ( max - min ) / 2 * 100% ] 8.58%
Standard Deviation 1652.0845
5th Percentile 58978.22
95th Percentile 64374.90
( 95th Percentile - 5th Percentile ) 5396.68
Mean Distribution
Standard Deviation 30.2132
95.00% Confidence Intervall ( 61516.44 - 61634.87 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2766
0.1 Scale Factor Error with Delta=300 23300
0.05 Scale Factor Error with Delta=300 93199
0.01 Scale Factor Error with Delta=300 2329959
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 2990
Mean 38540.53
Minimum 34912.00
Maximum 43210.17
Spread ( max - min ) 8298.17
Range [ ( max - min ) / 2 * 100% ] 10.77%
Standard Deviation 1231.2610
5th Percentile 36601.61
95th Percentile 40624.47
( 95th Percentile - 5th Percentile ) 4022.86
Mean Distribution
Standard Deviation 22.5172
95.00% Confidence Intervall ( 38496.39 - 38584.66 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3921
0.1 Scale Factor Error with Delta=300 12942
0.05 Scale Factor Error with Delta=300 51766
0.01 Scale Factor Error with Delta=300 1294148
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 2990
Mean 61575.65
Minimum 56723.25
Maximum 67289.14
Spread ( max - min ) 10565.89
Range [ ( max - min ) / 2 * 100% ] 8.58%
Damage
Sample Data blood of the enemy Damage
Count 2990
Mean 18406349.22
Minimum 14355746.40
Maximum 22246881.70
Spread ( max - min ) 7891135.29
Range [ ( max - min ) / 2 * 100% ] 21.44%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.27 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.74 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.95 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.97 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.63 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.40 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 86.68 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 81.22 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.52 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQKQPQKQNQPQPOQPKQKQPKLOPPQPPPQKQKQPQPQLKKOPPKQOPPQKQPPQNQKPKOIQPKOQPPQPNQJKQKQPKMPKOPPQPNQPQPKKPPKQOPPONQKQPQPKPQKQGIQKQPKNOOPPQPPKKPPQKPNQOPKQOPQQQKPQKNPQPKQPQKQPMOPKPNQPHEFIKQKQKQPKOQPQPQPKNKQPMPKQPQKQPLOPPPKPKQPQOQKPQNPPOPPKKGPIPQKNOQPQKQPPOQQJKQKQPQKLPPKOQPPQQQPKKONPQPQPKQOPPPJKQKQI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:03.089 default O moonfire enemy3 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.014 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(4), battle_potion_of_intellect
0:05.194 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(5), battle_potion_of_intellect
0:06.000 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(6), battle_potion_of_intellect
0:06.000 default G use_items Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(6), battle_potion_of_intellect
0:06.000 default I fury_of_elune Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(6), battle_potion_of_intellect, ignition_mages_fuse
0:06.754 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, bloodsoaked_counter(9), battle_potion_of_intellect, ignition_mages_fuse
0:07.508 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.264 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(11), battle_potion_of_intellect, ignition_mages_fuse
0:09.018 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(15), battle_potion_of_intellect, ignition_mages_fuse
0:09.773 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(16), battle_potion_of_intellect, ignition_mages_fuse
0:10.527 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(18), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.281 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(18), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.091 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.845 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.598 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.352 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(27), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.106 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(28), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.861 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.639 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(32), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.394 default P lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(33), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.147 default O moonfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(34), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.902 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(37), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.657 default P lunar_strike Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked_counter(39), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.425 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, overwhelming_power(22), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.178 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.932 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(21), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.687 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.442 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(24), bloodsoaked, ignition_mages_fuse(5)
0:24.194 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(23), bloodsoaked, ignition_mages_fuse(5)
0:24.948 default L sunfire Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked, ignition_mages_fuse(5)
0:25.702 default O moonfire enemy2 13.0/100: 13% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked, ignition_mages_fuse(5)
0:26.456 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked
0:27.421 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked
0:28.390 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(19)
0:29.145 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter
0:30.191 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(17), bloodsoaked_counter(2)
0:31.423 default P lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(16), bloodsoaked_counter(5)
0:32.658 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(15), bloodsoaked_counter(6)
0:33.485 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(14), bloodsoaked_counter(6)
0:34.317 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(8)
0:35.072 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked_counter(9)
0:35.827 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(9)
0:36.581 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), bloodsoaked_counter(9)
0:37.468 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(9)
0:38.223 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(11)
0:39.116 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(11)
0:39.871 default L sunfire Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(11)
0:40.626 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, overwhelming_power(23), bloodsoaked_counter(12)
0:41.502 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(13)
0:42.614 default O moonfire enemy3 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21), bloodsoaked_counter(13)
0:43.697 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25), bloodsoaked_counter(14)
0:45.059 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), bloodsoaked_counter(16)
0:46.431 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(19)
0:47.511 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), bloodsoaked_counter(19)
0:48.406 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(19)
0:49.463 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(19)
0:50.814 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(20)
0:52.171 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), bloodsoaked_counter(22)
0:53.083 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(23)
0:54.159 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), bloodsoaked_counter(24)
0:55.075 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(25)
0:56.456 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked_counter(25)
0:57.841 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(11), bloodsoaked_counter(25)
0:58.768 default N sunfire Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(25)
0:59.864 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked_counter(27)
1:00.799 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, overwhelming_power(8), bloodsoaked_counter(27)
1:02.001 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(6), bloodsoaked_counter(28)
1:03.498 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(5), bloodsoaked_counter(29)
1:04.680 default O moonfire enemy2 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(4), bloodsoaked_counter(29)
1:05.830 default I fury_of_elune Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(3), bloodsoaked_counter(29)
1:07.160 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power, bloodsoaked_counter(34)
1:08.152 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(36)
1:09.643 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), bloodsoaked_counter(39)
1:10.712 default O moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), bloodsoaked_counter(10), bloodsoaked
1:11.686 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), bloodsoaked_counter(10), bloodsoaked
1:12.517 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(10), bloodsoaked
1:13.766 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(10), bloodsoaked
1:15.019 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(10), bloodsoaked
1:15.863 default P lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(10), bloodsoaked
1:17.126 default N sunfire Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(10), bloodsoaked
1:18.123 default Q solar_wrath Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(16), bloodsoaked_counter(10)
1:19.036 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(15), bloodsoaked_counter(12)
1:19.036 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(15), bloodsoaked_counter(12)
1:20.209 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14), bloodsoaked_counter(12), conch_of_dark_whispers
1:21.054 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(13), bloodsoaked_counter(14), conch_of_dark_whispers
1:22.051 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24), bloodsoaked_counter(15), conch_of_dark_whispers
1:22.846 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(24), bloodsoaked_counter(19), conch_of_dark_whispers
1:24.036 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(20), conch_of_dark_whispers
1:24.975 default M moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(23), conch_of_dark_whispers
1:25.890 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(27), conch_of_dark_whispers
1:27.229 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(30), conch_of_dark_whispers
1:28.289 default O moonfire enemy2 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(33), conch_of_dark_whispers
1:29.353 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(34), conch_of_dark_whispers
1:30.715 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(35), conch_of_dark_whispers
1:32.081 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), bloodsoaked_counter(37), conch_of_dark_whispers
1:33.000 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(38), conch_of_dark_whispers
1:34.380 default N sunfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:35.394 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(11), bloodsoaked_counter(10), bloodsoaked
1:36.261 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), bloodsoaked_counter(10), bloodsoaked
1:37.561 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(10), bloodsoaked
1:38.431 default P lunar_strike Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(8), bloodsoaked_counter(10), bloodsoaked
1:39.972 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar(3), overwhelming_power(7), bloodsoaked_counter(10), bloodsoaked
1:41.096 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), bloodsoaked_counter(10), bloodsoaked
1:42.195 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), bloodsoaked_counter(12)
1:43.661 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3), bloodsoaked_counter(14)
1:45.133 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power, bloodsoaked_counter(14)
1:46.298 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(15)
1:47.265 default O moonfire enemy3 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(16)
1:48.401 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(19)
1:49.847 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(20)
1:51.295 default O moonfire Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), bloodsoaked_counter(22)
1:52.432 default N sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), bloodsoaked_counter(22)
1:53.569 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), bloodsoaked_counter(24)
1:54.536 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), bloodsoaked_counter(28)
1:55.672 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(28)
1:56.639 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(30)
1:58.087 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), bloodsoaked_counter(32)
1:59.052 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(34)
2:00.499 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), solar_empowerment, bloodsoaked_counter(38)
2:01.738 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(39)
2:03.270 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked
2:04.220 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, bloodsoaked
2:05.337 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked
2:06.142 default G use_items Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked
2:06.142 default I fury_of_elune Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked, ignition_mages_fuse
2:07.048 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked, ignition_mages_fuse
2:07.819 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), torrent_of_elements, bloodsoaked, ignition_mages_fuse
2:08.726 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse
2:09.482 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse
2:10.605 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:11.513 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter, ignition_mages_fuse(2)
2:12.557 default O moonfire enemy3 14.5/100: 14% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(3), ignition_mages_fuse(2)
2:13.603 default O moonfire enemy2 23.5/100: 24% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(3), ignition_mages_fuse(2)
2:14.647 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(6), ignition_mages_fuse(3)
2:15.924 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(6), ignition_mages_fuse(3)
2:17.202 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(6), ignition_mages_fuse(3)
2:18.055 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(2), starlord(3), bloodsoaked_counter(6), ignition_mages_fuse(3)
2:19.558 default P lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(2), starlord(3), bloodsoaked_counter(8), ignition_mages_fuse(4)
2:21.004 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(2), bloodsoaked_counter(11), ignition_mages_fuse(4)
2:22.055 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(13), ignition_mages_fuse(4)
2:23.077 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(13), ignition_mages_fuse(5)
2:24.296 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(13), ignition_mages_fuse(5)
2:25.516 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(13), ignition_mages_fuse(5)
2:26.330 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(13)
2:27.499 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(15)
2:28.947 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(17)
2:30.085 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(18)
2:31.052 default O moonfire enemy3 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(18)
2:32.188 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(19)
2:33.635 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(21)
2:34.771 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(21)
2:35.736 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(21)
2:36.874 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(21)
2:38.322 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), bloodsoaked_counter(21)
2:39.287 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), bloodsoaked_counter(21)
2:40.255 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), bloodsoaked_counter(22)
2:41.221 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), bloodsoaked_counter(23)
2:42.458 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(23)
2:43.989 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), solar_empowerment, starlord, bloodsoaked_counter(26)
2:45.012 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), starlord, bloodsoaked_counter(26)
2:46.213 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(29)
2:47.382 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(31)
2:48.871 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), bloodsoaked_counter(33)
2:49.864 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), starlord(2), bloodsoaked_counter(33)
2:51.615 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(25), bloodsoaked_counter(34)
2:52.683 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(34)
2:53.454 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked_counter(36)
2:54.612 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(37)
2:55.387 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, starlord(3), overwhelming_power(21), bloodsoaked_counter(39)
2:56.302 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked_counter(39)
2:57.085 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(10), bloodsoaked
2:58.182 default M moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(18), bloodsoaked_counter(10), bloodsoaked
2:59.046 default O moonfire enemy3 32.5/100: 33% astral_power arcanic_pulsar, starlord(3), overwhelming_power(17), bloodsoaked_counter(10), bloodsoaked
3:00.042 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord(3), overwhelming_power(16), bloodsoaked_counter(10), bloodsoaked
3:01.539 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(15), bloodsoaked_counter(10), bloodsoaked
3:02.634 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14), bloodsoaked_counter(10), bloodsoaked
3:03.991 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, overwhelming_power(13), bloodsoaked_counter(10), bloodsoaked
3:05.060 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, overwhelming_power(11), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
3:05.976 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), bloodsoaked_counter(10), conch_of_dark_whispers
3:07.448 default H celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, overwhelming_power(9), bloodsoaked_counter(14), conch_of_dark_whispers
3:08.463 default E potion Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(14), conch_of_dark_whispers
3:08.463 default F berserking Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:08.463 default I fury_of_elune Fluffy_Pillow 89.0/100: 89% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:09.386 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment, starlord, overwhelming_power(7), bloodsoaked_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:10.313 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), bloodsoaked_counter(22), conch_of_dark_whispers, battle_potion_of_intellect
3:11.082 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(5), bloodsoaked_counter(22), conch_of_dark_whispers, battle_potion_of_intellect
3:11.990 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), bloodsoaked_counter(24), conch_of_dark_whispers, battle_potion_of_intellect
3:12.745 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), bloodsoaked_counter(29), conch_of_dark_whispers, battle_potion_of_intellect
3:13.631 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(3), bloodsoaked_counter(31), conch_of_dark_whispers, battle_potion_of_intellect
3:14.390 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(2), bloodsoaked_counter(33), conch_of_dark_whispers, battle_potion_of_intellect
3:15.527 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power, bloodsoaked_counter(39), conch_of_dark_whispers, battle_potion_of_intellect
3:16.421 default O moonfire enemy3 7.5/100: 8% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:17.192 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:17.947 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:18.931 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:19.686 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:20.679 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:21.436 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:22.534 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(18), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:23.478 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:24.395 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:25.384 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(2), conch_of_dark_whispers, battle_potion_of_intellect
3:26.204 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(4), conch_of_dark_whispers, battle_potion_of_intellect
3:27.434 default M moonfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(5), conch_of_dark_whispers, battle_potion_of_intellect
3:28.403 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(7), conch_of_dark_whispers, battle_potion_of_intellect
3:29.827 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(9), battle_potion_of_intellect
3:30.895 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(10), battle_potion_of_intellect
3:31.667 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(12), battle_potion_of_intellect
3:32.826 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(16), battle_potion_of_intellect
3:33.604 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(17)
3:34.520 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(20)
3:35.301 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(22)
3:36.476 default L sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(24)
3:37.404 default O moonfire enemy3 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(25)
3:38.472 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(16), bloodsoaked_counter(28)
3:39.837 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(3), overwhelming_power(15), bloodsoaked_counter(28)
3:41.450 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, starlord(3), overwhelming_power(13), bloodsoaked_counter(31)
3:43.074 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(11), bloodsoaked_counter(34)
3:44.264 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(10), bloodsoaked_counter(35)
3:45.740 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, overwhelming_power(9), bloodsoaked_counter(38)
3:46.903 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(10), bloodsoaked
3:47.801 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(10), bloodsoaked
3:49.149 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(10), bloodsoaked
3:50.056 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(10), bloodsoaked
3:51.127 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(10), bloodsoaked
3:52.040 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), starlord(2), torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(10), bloodsoaked
3:53.119 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked_counter(10), bloodsoaked
3:54.460 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10)
3:55.426 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, bloodsoaked_counter(11)
3:56.563 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, bloodsoaked_counter(14)
3:58.265 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, bloodsoaked_counter(15)
3:59.967 default O moonfire enemy3 60.0/100: 60% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, bloodsoaked_counter(17)
4:01.104 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(20)
4:02.807 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(22)
4:04.511 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(4), bloodsoaked_counter(23)
4:05.749 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(26)
4:06.951 default G use_items Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(26)
4:06.951 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(26), ignition_mages_fuse
4:08.376 default I fury_of_elune Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(27), ignition_mages_fuse
4:09.583 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(28), ignition_mages_fuse
4:11.009 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(30), ignition_mages_fuse(2)
4:11.921 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(31), ignition_mages_fuse(2)
4:12.994 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(32), ignition_mages_fuse(2)
4:14.038 default O moonfire enemy2 39.0/100: 39% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(34), ignition_mages_fuse(2)
4:15.083 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(36), ignition_mages_fuse(3)
4:15.937 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(39), ignition_mages_fuse(3)
4:17.215 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(3)
4:18.015 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(3)
4:18.955 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(4)
4:19.727 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(4)
4:20.883 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(4)
4:22.039 default O moonfire enemy3 80.0/100: 80% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(4)
4:22.947 default Q solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(4)
4:23.718 default Q solar_wrath Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(5)
4:24.472 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(5)
4:24.472 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), solar_empowerment, torrent_of_elements, bloodsoaked, ignition_mages_fuse(5)
4:25.427 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(5)
4:26.180 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter, ignition_mages_fuse(5)
4:27.038 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(2)
4:27.902 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(2)
4:29.196 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(3)
4:30.057 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(3)
4:31.072 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(5)
4:32.061 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(8)
4:33.507 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(8)
4:34.954 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(9)
4:36.091 default O moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(9)
4:37.229 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(11)
4:38.198 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(13)
4:39.647 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(13)
4:41.094 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(13)
4:42.059 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(13)
4:43.026 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), bloodsoaked_counter(14)
4:43.991 default P lunar_strike Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(3), starlord(3), bloodsoaked_counter(14)
4:45.693 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(3), bloodsoaked_counter(16)
4:46.932 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(16)
4:48.134 default O moonfire enemy2 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(18)
4:49.301 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(21)
4:50.470 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(21)
4:51.959 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), bloodsoaked_counter(21)
4:52.951 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(21)
4:54.439 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), bloodsoaked_counter(21)
4:55.431 default P lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(23)
4:56.920 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(24)
4:58.088 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(25)
4:59.053 default O moonfire enemy3 55.0/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(25)
5:00.191 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(27)
5:01.637 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(28)
5:02.967 default P lunar_strike Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(28)
5:04.299 default J cancel_buff Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(30)
5:04.299 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar(6), solar_empowerment(2), overwhelming_power(21), bloodsoaked_counter(30)
5:05.447 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(20), bloodsoaked_counter(31)
5:06.398 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(19), bloodsoaked_counter(31)
5:07.521 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(18), bloodsoaked_counter(33)
5:08.451 default I fury_of_elune Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), bloodsoaked_counter(33)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

crucible of flame : 60856 dps, 37819 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
60856.0 60856.0 58.5 / 0.096% 6291.4 / 10.3% 7583.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 7.9 Astral Power 0.00% 57.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
crucible of flame 60856
Ancient Flame 1286 2.1% 25.2 11.59sec 15288 0 Periodic 108.5 2984 5969 3545 18.8% 70.9%

Stats details: ancient_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.16 0.00 108.53 108.53 0.0000 1.9571 384691.67 384691.67 0.00 1811.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.2 81.23% 2984.26 2 7186 2974.81 2200 4248 263073 263073 0.00
crit 20.4 18.77% 5969.48 4 14373 5944.32 4060 10857 121619 121619 0.00
 
 

Action details: ancient_flame

Static Values
  • id:295367
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295367
  • name:Ancient Flame
  • school:fire
  • tooltip:Suffering $w1 fire damage every $t1 sec.
  • description:{$@spelldesc295365=Your spells and abilities have a chance to cauterize your target for ${$m3*5} Fire damage over {$295367d=10 seconds} or healing an ally for ${$m3*5} over {$295367d=10 seconds}$?a295369[, stacking up to {$295367u=1} times][].}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1582.83
  • base_td_mult:1.25
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fury of Elune 2589 4.2% 5.3 60.78sec 144627 142717 Direct 388.3 1680 3354 1990 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 388.35 142.37 0.00 1.0135 0.2960 772957.21 772957.21 0.00 16253.96 142717.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 316.42 81.48% 1680.33 1457 1987 1682.05 1577 1831 531692 531692 0.00
crit 71.93 18.52% 3354.24 2915 3974 3357.33 3081 3731 241265 241265 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 300 (685) 0.5% (1.1%) 8.3 32.91sec 24796 0 Direct 8.3 9132 18260 10841 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 89695.65 89695.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.28% 9131.97 8921 9813 9129.88 0 9813 61407 61407 0.00
crit 1.55 18.72% 18259.86 17842 19626 14422.49 0 19626 28288 28288 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 386 0.6% 8.3 32.91sec 13955 0 Direct 24.8 3913 7829 4652 18.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 24.82 0.00 0.00 0.0000 0.0000 115459.16 115459.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.14 81.14% 3913.27 3823 4206 3913.66 3823 4206 78816 78816 0.00
crit 4.68 18.86% 7829.34 7646 8411 7684.56 0 8411 36643 36643 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 9979 16.4% 84.8 3.49sec 35212 26340 Direct 254.5 9883 19788 11737 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.82 254.46 0.00 0.00 1.3368 0.0000 2986652.92 2986652.92 0.00 26340.11 26340.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 206.82 81.28% 9882.91 3345 24211 9889.55 8961 11043 2044038 2044038 0.00
crit 47.64 18.72% 19787.66 6689 48422 19800.32 13994 27473 942615 942615 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9547 15.7% 27.3 10.91sec 104648 101074 Direct 54.6 3523 7045 4181 18.7%  
Periodic 666.6 3323 6639 3942 18.7% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.29 54.58 666.58 666.58 1.0354 1.3328 2855642.16 2855642.16 0.00 3115.31 101073.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.39 81.33% 3523.35 3280 4472 3524.45 3349 3727 156385 156385 0.00
crit 10.19 18.67% 7045.46 6559 8943 7046.84 6559 7958 71794 71794 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 542.2 81.33% 3322.63 6 4163 3324.20 3244 3445 1801395 1801395 0.00
crit 124.4 18.67% 6639.38 20 8327 6642.01 6381 7061 826067 826067 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2792 (8603) 4.6% (14.1%) 79.6 3.68sec 32330 37045 Direct 80.2 8767 17534 10405 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.61 80.22 0.00 0.00 0.8727 0.0000 834712.38 834712.38 0.00 37044.96 37044.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.24 81.32% 8767.41 7949 10838 8772.30 8499 9235 571981 571981 0.00
crit 14.98 18.68% 17533.70 15898 21676 17540.40 15898 19815 262732 262732 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 5812 9.6% 74.6 3.91sec 23314 0 Direct 223.8 7772 0 7772 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.59 223.77 0.00 0.00 0.0000 0.0000 1738986.42 1738986.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.77 100.00% 7771.50 5962 16257 7774.25 6740 8946 1738986 1738986 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11923.38
  • base_dd_max:11923.38
  • base_dd_mult:1.00
 
Starsurge 13327 21.9% 60.0 5.01sec 66452 63767 Direct 59.8 56246 112385 66677 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.97 59.77 0.00 0.00 1.0421 0.0000 3985270.17 3985270.17 0.00 63767.38 63767.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.66 81.42% 56245.65 51347 69612 56271.67 54345 58793 2737145 2737145 0.00
crit 11.11 18.58% 112384.57 102695 139223 112420.15 102695 132895 1248125 1248125 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5889 9.6% 90.1 3.08sec 19437 0 Direct 90.1 16381 32773 19437 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.10 90.10 0.00 0.00 0.0000 0.0000 1751245.65 1751245.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.30 81.36% 16380.91 16021 17623 16381.12 16021 17188 1200783 1200783 0.00
crit 16.80 18.64% 32773.21 32042 35246 32772.46 32042 34890 550463 550463 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 8949 14.7% 18.1 16.71sec 147463 145395 Direct 18.1 4506 9011 5347 18.7%  
Periodic 669.9 3245 6487 3850 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 669.89 669.89 1.0142 1.3321 2676288.92 2676288.92 0.00 2938.41 145395.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.76 81.35% 4506.34 4112 5607 4507.49 4225 4820 66531 66531 0.00
crit 3.38 18.65% 9011.05 8225 11214 8760.56 0 11214 30501 30501 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 544.7 81.32% 3244.66 17 4065 3246.15 3170 3362 1767503 1767503 0.00
crit 125.1 18.68% 6486.68 26 8130 6489.58 6220 6893 811754 811754 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
crucible of flame
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.42sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.12sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8991 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 52.7 45.0sec 5.0sec 93.48% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.43%
  • arcanic_pulsar_2:11.08%
  • arcanic_pulsar_3:11.45%
  • arcanic_pulsar_4:9.51%
  • arcanic_pulsar_5:13.87%
  • arcanic_pulsar_6:11.47%
  • arcanic_pulsar_7:9.56%
  • arcanic_pulsar_8:15.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.2sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.3sec 182.3sec 8.12% 7.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.72% 34.18% 0.0(0.0) 8.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.6sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.09% 0.00% 84.3(84.3) 5.2

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.7 42.4 9.0sec 3.9sec 78.93% 86.05% 1.8(1.8) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.73%
  • lunar_empowerment_2:28.01%
  • lunar_empowerment_3:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.5 64.3sec 33.7sec 48.23% 0.00% 3.5(48.1) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.25%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.39%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.1 49.9 10.9sec 3.9sec 84.77% 92.95% 0.2(0.2) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.46%
  • solar_empowerment_2:38.48%
  • solar_empowerment_3:15.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 44.8 20.4sec 5.0sec 97.12% 92.42% 15.0(15.0) 12.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.31%
  • starlord_2:21.73%
  • starlord_3:59.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.9sec 45.5sec 23.57% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.57%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
crucible of flame
starsurge Astral Power 60.0 2398.9 40.0 40.0 1661.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 80.61 644.53 (27.28%) 8.00 0.32 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.39%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.25 210.54 (8.91%) 2.50 0.07 0.03%
sunfire Astral Power 18.15 54.44 (2.30%) 3.00 0.00 0.00%
moonfire Astral Power 27.29 81.87 (3.47%) 3.00 0.00 0.00%
lunar_strike Astral Power 84.82 1017.47 (43.07%) 12.00 0.38 0.04%
natures_balance Astral Power 399.85 199.91 (8.46%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.15 73.84 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.89 8.01
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.56 0.00 65.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data crucible of flame Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data crucible of flame Damage Per Second
Count 2990
Mean 60856.01
Minimum 55985.87
Maximum 66276.47
Spread ( max - min ) 10290.60
Range [ ( max - min ) / 2 * 100% ] 8.45%
Standard Deviation 1631.7051
5th Percentile 58290.18
95th Percentile 63614.93
( 95th Percentile - 5th Percentile ) 5324.75
Mean Distribution
Standard Deviation 29.8405
95.00% Confidence Intervall ( 60797.53 - 60914.50 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2762
0.1 Scale Factor Error with Delta=300 22729
0.05 Scale Factor Error with Delta=300 90914
0.01 Scale Factor Error with Delta=300 2272831
Priority Target DPS
Sample Data crucible of flame Priority Target Damage Per Second
Count 2990
Mean 37818.94
Minimum 33942.25
Maximum 41696.11
Spread ( max - min ) 7753.85
Range [ ( max - min ) / 2 * 100% ] 10.25%
Standard Deviation 1204.6330
5th Percentile 35957.89
95th Percentile 39889.32
( 95th Percentile - 5th Percentile ) 3931.43
Mean Distribution
Standard Deviation 22.0302
95.00% Confidence Intervall ( 37775.76 - 37862.12 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3898
0.1 Scale Factor Error with Delta=300 12388
0.05 Scale Factor Error with Delta=300 49552
0.01 Scale Factor Error with Delta=300 1238778
DPS(e)
Sample Data crucible of flame Damage Per Second (Effective)
Count 2990
Mean 60856.01
Minimum 55985.87
Maximum 66276.47
Spread ( max - min ) 10290.60
Range [ ( max - min ) / 2 * 100% ] 8.45%
Damage
Sample Data crucible of flame Damage
Count 2990
Mean 18191602.30
Minimum 14412794.82
Maximum 22248158.81
Spread ( max - min ) 7835363.99
Range [ ( max - min ) / 2 * 100% ] 21.54%
DTPS
Sample Data crucible of flame Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data crucible of flame Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data crucible of flame Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data crucible of flame Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data crucible of flame Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data crucible of flame Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data crucible of flameTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data crucible of flame Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.08 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.97 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.01 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.84 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.45 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 85.19 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 79.83 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.56 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQKQPKQPNQPQPOQOKQKQPKLPPPQQPQPKQKQPQPQMKKNOPPKQPQQKPQPPKNOOIPKPKQPQQPPNPKQKQKQPOOPKPPNQPPPKKOPPKQPOQNQKPQQPPKGIOKQPKQPKNOPPKQPQQPKPQPKNOPQQKOPPQQPKPKNPQQPKOQPKQMPPHEFIKNKQPKQPQKQPKQPQPQPMNOKQPQPKQPPKQPKQPLOOQKQPKQPPKQPNPQQGIOOKKQPKQPQKNQPQPPQQQJKQKQPKMOPKNPPQPQQPKKQPOPKNOQPQKPQQIP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask crucible of flame 58.0/100: 58% astral_power
Pre precombat 1 food crucible of flame 58.0/100: 58% astral_power
Pre precombat 2 augmentation crucible of flame 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.163 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.090 default O moonfire enemy2 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.015 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.195 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.002 default F berserking Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.002 default G use_items Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.002 default I fury_of_elune Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.757 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:07.511 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.266 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.020 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.775 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.531 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.284 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.093 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.849 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.604 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.414 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.168 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.923 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.700 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.454 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.232 default O moonfire enemy3 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.988 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.743 default O moonfire enemy2 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.497 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.251 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.006 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.759 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.513 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.328 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.084 default L sunfire Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.838 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.751 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3)
0:27.866 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:28.979 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:29.733 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:30.486 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:31.798 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:32.553 default P lunar_strike Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:33.865 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:34.741 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:35.495 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3)
0:36.257 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:37.013 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:37.983 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:38.738 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:39.709 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3)
0:40.470 default M moonfire Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3)
0:41.230 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar
0:42.468 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
0:43.673 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:44.840 default O moonfire enemy3 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:46.009 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:47.496 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:48.984 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:50.153 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:51.118 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:52.567 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:53.535 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), conch_of_dark_whispers
0:54.499 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), starlord(3), conch_of_dark_whispers
0:55.635 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
0:57.082 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
0:58.048 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
0:59.751 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), starlord(3)
1:01.453 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(5)
1:02.692 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:03.896 default O moonfire enemy3 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:05.100 default O moonfire enemy2 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:06.301 default I fury_of_elune Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:07.502 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment, starlord
1:09.033 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment, starlord
1:10.236 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2)
1:11.723 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(24)
1:12.796 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
1:13.685 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
1:15.023 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(20)
1:15.920 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20)
1:16.822 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19)
1:18.411 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17)
1:20.010 default N sunfire Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15)
1:21.086 default P lunar_strike Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14)
1:22.703 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar(8), overwhelming_power(13)
1:23.886 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12)
1:24.737 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(11)
1:25.742 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10)
1:26.576 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(9)
1:27.560 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8)
1:28.375 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(7)
1:29.603 default O moonfire enemy3 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(6)
1:30.715 default O moonfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(5)
1:31.831 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(4)
1:33.257 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(2)
1:34.387 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power
1:35.830 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3)
1:37.279 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:38.416 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:39.383 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), starlord(3)
1:41.086 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(24)
1:42.648 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(23)
1:44.216 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(3), overwhelming_power(21)
1:45.363 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20)
1:46.483 default O moonfire enemy3 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19)
1:47.574 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
1:48.969 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17)
1:50.368 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(15)
1:51.474 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
1:52.390 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
1:53.771 default O moonfire enemy2 23.5/100: 24% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(12)
1:54.858 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(11)
1:55.785 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(10)
1:56.879 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(9)
1:57.816 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(8)
1:58.920 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7)
2:00.331 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(5)
2:01.280 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(4)
2:02.233 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(3)
2:03.918 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(2)
2:05.610 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), torrent_of_elements
2:06.848 default G use_items Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
2:06.848 default I fury_of_elune Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse
2:08.001 default O moonfire enemy3 32.0/100: 32% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse
2:09.153 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse
2:10.306 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse
2:11.135 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:12.325 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:13.260 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(2)
2:14.014 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(2)
2:15.085 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(3)
2:15.900 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(3)
2:16.834 default O moonfire enemy2 11.0/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(3)
2:17.772 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(3)
2:18.973 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
2:20.134 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(17), ignition_mages_fuse(4)
2:21.051 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), ignition_mages_fuse(4)
2:21.832 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), ignition_mages_fuse(4)
2:23.004 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(5)
2:23.762 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(14), ignition_mages_fuse(5)
2:24.522 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(13), ignition_mages_fuse(5)
2:25.862 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), overwhelming_power(12), ignition_mages_fuse(5)
2:26.839 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), ignition_mages_fuse(5)
2:28.053 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(9)
2:29.044 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), starlord, overwhelming_power(8), conch_of_dark_whispers
2:30.794 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), starlord, overwhelming_power(7), conch_of_dark_whispers
2:31.963 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(6), conch_of_dark_whispers
2:33.105 default O moonfire enemy3 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(4), conch_of_dark_whispers
2:34.258 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(3), conch_of_dark_whispers
2:35.730 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
2:36.718 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power, conch_of_dark_whispers
2:37.709 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(2), conch_of_dark_whispers
2:38.878 default O moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
2:40.014 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
2:41.462 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:42.910 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:43.877 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers
2:44.843 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), starlord(3)
2:46.546 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(6)
2:47.783 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:49.315 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), solar_empowerment, starlord
2:50.517 default N sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:51.685 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
2:53.050 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(22)
2:53.967 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(22)
2:54.886 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(21)
2:56.510 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(19)
2:57.602 default O moonfire enemy2 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18)
2:58.529 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17)
2:59.320 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16)
3:00.510 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15)
3:01.445 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14)
3:02.243 default M moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13)
3:03.185 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(12)
3:04.571 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11)
3:05.962 default H celestial_alignment Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(25)
3:06.867 default E potion Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, overwhelming_power(24)
3:06.867 default F berserking Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, overwhelming_power(24), battle_potion_of_intellect
3:06.867 default I fury_of_elune Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, overwhelming_power(24), battle_potion_of_intellect
3:07.768 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, overwhelming_power(23), battle_potion_of_intellect
3:08.669 default N sunfire Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(22), battle_potion_of_intellect
3:09.547 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(21), battle_potion_of_intellect
3:10.430 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(20), battle_potion_of_intellect
3:11.184 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), battle_potion_of_intellect
3:12.284 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), battle_potion_of_intellect
3:13.151 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:13.906 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:14.983 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:15.736 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:16.587 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:17.341 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:18.433 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:19.293 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:20.101 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:21.314 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:22.127 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:23.349 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:24.169 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:25.400 default M moonfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:26.305 default N sunfire Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect
3:27.346 default O moonfire enemy2 76.0/100: 76% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:28.392 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:29.534 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:30.480 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect
3:31.906 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(19)
3:32.862 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(18)
3:34.296 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(16)
3:35.431 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(15)
3:36.372 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14)
3:37.786 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13)
3:39.204 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
3:40.326 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
3:41.137 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
3:42.354 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
3:43.314 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), conch_of_dark_whispers
3:44.135 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
3:45.366 default L sunfire Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5), conch_of_dark_whispers
3:46.336 default O moonfire enemy2 58.5/100: 59% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
3:47.456 default O moonfire Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
3:48.579 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), overwhelming_power(2), conch_of_dark_whispers
3:49.627 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), overwhelming_power, conch_of_dark_whispers
3:50.860 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord, conch_of_dark_whispers
3:51.882 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers
3:53.411 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
3:54.614 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:55.607 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
3:57.096 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:58.584 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
3:59.754 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:00.721 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:02.169 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
4:03.304 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
4:04.752 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
4:05.721 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
4:06.687 default G use_items Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
4:06.687 default I fury_of_elune Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), ignition_mages_fuse
4:07.956 default O moonfire Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(4), fury_of_elune, solar_empowerment, starlord(3), ignition_mages_fuse
4:09.045 default O moonfire enemy3 84.0/100: 84% astral_power arcanic_pulsar(4), fury_of_elune, solar_empowerment, starlord(3), ignition_mages_fuse
4:10.132 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(4), fury_of_elune, solar_empowerment, ignition_mages_fuse
4:11.319 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse(2)
4:12.425 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(2)
4:13.338 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(2)
4:14.706 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), ignition_mages_fuse(3)
4:15.657 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
4:16.450 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
4:17.639 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
4:18.435 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(3)
4:19.373 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
4:20.282 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
4:21.057 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
4:22.220 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), ignition_mages_fuse(4)
4:23.001 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
4:24.132 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), ignition_mages_fuse(5)
4:25.266 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(5)
4:26.024 default Q solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(13), ignition_mages_fuse(5)
4:26.787 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13)
4:27.869 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(12)
4:27.869 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(12)
4:29.054 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10)
4:29.911 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(10)
4:30.919 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9)
4:31.756 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(8)
4:33.012 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(6)
4:34.006 default M moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5)
4:34.977 default O moonfire enemy2 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5)
4:36.093 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3)
4:37.524 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(2)
4:38.650 default N sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers
4:39.785 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:41.233 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:42.680 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:43.646 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:45.094 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:46.062 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
4:47.029 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), conch_of_dark_whispers
4:48.476 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(3), solar_empowerment, conch_of_dark_whispers
4:49.714 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
4:50.915 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
4:51.908 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:53.398 default O moonfire enemy2 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:54.567 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:56.056 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
4:57.225 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
4:58.360 default O moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
4:59.496 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
5:00.462 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
5:01.909 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
5:02.875 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
5:04.011 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
5:05.459 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
5:06.426 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
5:07.392 default I fury_of_elune Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), starlord(3)
5:08.527 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), fury_of_elune, overwhelming_power(24)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="crucible of flame"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

focusing iris : 61740 dps, 38585 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
61739.7 61739.7 57.4 / 0.093% 6218.1 / 10.1% 7470.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 59.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 61740
Fury of Elune 2754 4.5% 5.3 60.75sec 154007 161934 Direct 413.4 1680 3355 1990 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 413.43 148.43 0.00 0.9512 0.2841 822623.16 822623.16 0.00 17411.49 161933.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 337.00 81.51% 1680.12 1457 1987 1681.64 1599 1850 566191 566191 0.00
crit 76.43 18.49% 3355.12 2915 3974 3357.74 3110 3706 256432 256432 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 306 (698) 0.5% (1.1%) 8.5 31.83sec 24724 0 Direct 8.5 9129 18275 10829 18.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.46 8.46 0.00 0.00 0.0000 0.0000 91619.45 91619.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.89 81.43% 9128.76 8921 9813 9128.98 8921 9813 62898 62898 0.00
crit 1.57 18.57% 18274.76 17842 19626 14621.20 0 19626 28722 28722 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 392 0.6% 8.5 31.83sec 13897 0 Direct 25.4 3913 7827 4632 18.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.46 25.39 0.00 0.00 0.0000 0.0000 117592.36 117592.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.72 81.62% 3912.95 3823 4206 3912.90 3823 4206 81073 81073 0.00
crit 4.67 18.38% 7826.57 7646 8411 7717.71 0 8411 36520 36520 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 10373 16.8% 88.6 3.34sec 35025 27054 Direct 265.9 9841 19596 11675 18.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.63 265.88 0.00 0.00 1.2946 0.0000 3104123.68 3104123.68 0.00 27054.25 27054.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.89 81.20% 9841.24 3345 24211 9848.30 8815 10939 2124609 2124609 0.00
crit 49.99 18.80% 19595.98 6689 48422 19606.93 14272 25163 979514 979514 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9907 16.1% 27.6 10.81sec 107523 107288 Direct 55.1 3521 7037 4177 18.7%  
Periodic 692.2 3327 6652 3949 18.7% 296.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.56 55.12 692.16 692.16 1.0022 1.2842 2963184.72 2963184.72 0.00 3233.21 107287.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.83 81.34% 3521.04 3280 4472 3521.98 3363 3750 157856 157856 0.00
crit 10.28 18.66% 7036.77 6559 8943 7035.00 0 7901 72365 72365 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 562.8 81.31% 3327.08 2 4163 3328.61 3242 3453 1872562 1872562 0.00
crit 129.3 18.69% 6652.46 9 8327 6655.23 6394 7103 860402 860402 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2893 (8906) 4.7% (14.4%) 82.5 3.54sec 32304 38071 Direct 83.1 8780 17550 10414 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.50 83.09 0.00 0.00 0.8485 0.0000 865265.71 865265.71 0.00 38070.82 38070.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.61 81.37% 8779.51 7949 10838 8784.79 8496 9180 593598 593598 0.00
crit 15.48 18.63% 17549.99 15898 21676 17558.47 16057 19937 271668 271668 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 6013 9.8% 77.1 3.77sec 23346 0 Direct 231.3 7782 0 7782 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.09 231.27 0.00 0.00 0.0000 0.0000 1799729.99 1799729.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 231.27 100.00% 7782.35 5962 16257 7786.12 6901 9238 1799730 1799730 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13719 22.2% 61.8 4.87sec 66419 65917 Direct 61.5 56204 112263 66665 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.76 61.54 0.00 0.00 1.0076 0.0000 4102391.83 4102391.83 0.00 65916.70 65916.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.07 81.35% 56204.45 51347 69612 56231.96 54177 59212 2814012 2814012 0.00
crit 11.48 18.65% 112263.00 102695 139223 112303.61 102695 127608 1288380 1288380 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6088 9.8% 93.1 3.00sec 19450 0 Direct 93.1 16389 32797 19450 18.7%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.13 93.13 0.00 0.00 0.0000 0.0000 1811327.54 1811327.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.76 81.35% 16389.28 16021 17623 16389.24 16021 17165 1241592 1241592 0.00
crit 17.37 18.65% 32796.75 32042 35246 32794.14 32042 34788 569735 569735 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 9294 15.1% 18.1 16.74sec 153398 156206 Direct 18.1 4517 9013 5354 18.6%  
Periodic 695.7 3249 6495 3856 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.12 18.12 695.68 695.68 0.9821 1.2830 2779537.22 2779537.22 0.00 3053.25 156206.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.74 81.37% 4517.01 4112 5607 4518.39 4245 4820 66595 66595 0.00
crit 3.38 18.63% 9012.59 8225 11214 8803.12 0 11214 30431 30431 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 565.5 81.29% 3248.74 29 4065 3250.23 3169 3371 1837315 1837315 0.00
crit 130.1 18.71% 6494.76 97 8130 6497.42 6199 6932 845196 845196 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.59sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.39sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8787 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.3 43.9sec 4.9sec 93.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.51%
  • arcanic_pulsar_2:10.02%
  • arcanic_pulsar_3:11.59%
  • arcanic_pulsar_4:9.95%
  • arcanic_pulsar_5:13.38%
  • arcanic_pulsar_6:11.59%
  • arcanic_pulsar_7:11.03%
  • arcanic_pulsar_8:13.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.4sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.12% 8.37% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.1 0.0 37.9sec 37.9sec 26.05% 33.89% 0.0(0.0) 8.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.5sec 45.3sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Energy 9.0 255.4 26.5sec 1.1sec 98.87% 97.63% 209.2(209.2) 8.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:35.52

Stack Uptimes

  • focused_energy_3:4.56%
  • focused_energy_4:3.87%
  • focused_energy_5:3.65%
  • focused_energy_6:3.10%
  • focused_energy_7:2.80%
  • focused_energy_8:2.42%
  • focused_energy_9:2.27%
  • focused_energy_10:76.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.7sec 60.7sec 14.09% 0.00% 84.3(84.3) 5.2

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 35.5 42.9 8.5sec 3.8sec 78.30% 84.96% 1.9(1.9) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:37.06%
  • lunar_empowerment_2:27.47%
  • lunar_empowerment_3:13.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.7 64.0sec 32.8sec 48.83% 0.00% 3.7(51.4) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.39%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.47%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.60%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.69%
  • overwhelming_power_9:1.74%
  • overwhelming_power_10:1.79%
  • overwhelming_power_11:1.84%
  • overwhelming_power_12:1.89%
  • overwhelming_power_13:1.95%
  • overwhelming_power_14:2.01%
  • overwhelming_power_15:2.07%
  • overwhelming_power_16:2.14%
  • overwhelming_power_17:2.21%
  • overwhelming_power_18:2.27%
  • overwhelming_power_19:2.35%
  • overwhelming_power_20:2.42%
  • overwhelming_power_21:2.50%
  • overwhelming_power_22:2.58%
  • overwhelming_power_23:2.66%
  • overwhelming_power_24:2.74%
  • overwhelming_power_25:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 28.9 50.5 10.3sec 3.8sec 83.86% 92.75% 0.1(0.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.79%
  • solar_empowerment_2:38.12%
  • solar_empowerment_3:14.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 46.6 20.3sec 4.9sec 97.41% 93.53% 16.6(16.6) 12.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.15%
  • starlord_2:21.98%
  • starlord_3:60.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.7sec 45.4sec 23.83% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.83%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 61.8 2470.6 40.0 40.0 1660.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 83.50 667.60 (27.42%) 8.00 0.37 0.06%
celestial_alignment Astral Power 2.00 80.00 (3.29%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.30 210.74 (8.66%) 2.50 0.01 0.00%
sunfire Astral Power 18.12 54.36 (2.23%) 3.00 0.00 0.00%
moonfire Astral Power 27.56 82.68 (3.40%) 3.00 0.00 0.00%
lunar_strike Astral Power 88.63 1063.16 (43.67%) 12.00 0.38 0.04%
natures_balance Astral Power 399.85 199.91 (8.21%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.35 76.17 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.13 8.25
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.18 0.00 71.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data focusing iris Damage Per Second
Count 2990
Mean 61739.67
Minimum 57317.21
Maximum 67429.54
Spread ( max - min ) 10112.33
Range [ ( max - min ) / 2 * 100% ] 8.19%
Standard Deviation 1600.7781
5th Percentile 59282.77
95th Percentile 64534.82
( 95th Percentile - 5th Percentile ) 5252.05
Mean Distribution
Standard Deviation 29.2749
95.00% Confidence Intervall ( 61682.29 - 61797.04 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2583
0.1 Scale Factor Error with Delta=300 21875
0.05 Scale Factor Error with Delta=300 87500
0.01 Scale Factor Error with Delta=300 2187490
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 2990
Mean 38585.05
Minimum 35240.35
Maximum 42612.85
Spread ( max - min ) 7372.50
Range [ ( max - min ) / 2 * 100% ] 9.55%
Standard Deviation 1178.5925
5th Percentile 36796.98
95th Percentile 40641.44
( 95th Percentile - 5th Percentile ) 3844.47
Mean Distribution
Standard Deviation 21.5540
95.00% Confidence Intervall ( 38542.81 - 38627.30 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3585
0.1 Scale Factor Error with Delta=300 11858
0.05 Scale Factor Error with Delta=300 47432
0.01 Scale Factor Error with Delta=300 1185799
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 2990
Mean 61739.67
Minimum 57317.21
Maximum 67429.54
Spread ( max - min ) 10112.33
Range [ ( max - min ) / 2 * 100% ] 8.19%
Damage
Sample Data focusing iris Damage
Count 2990
Mean 18457395.65
Minimum 14560589.06
Maximum 23004628.67
Spread ( max - min ) 8444039.61
Range [ ( max - min ) / 2 * 100% ] 22.87%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.29 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.77 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.86 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.82 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.72 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.74 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 89.01 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 82.71 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.54 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQPKQPKQNQPQPOQRKQPKQPKOPPPQQQPKQKQPQPQLJKKOPPKQPOPKQPQNQPPKPKOPIQQKPOQNPPJKQKQKQPPKOQPPKNOQPQQKPQPKPQONQKPQPOPKPQQKQGQIQKQLOKPPPQOPKKQPPKNQPQQKOPQPPPOKPKNPQPKQPQKQPOQPPNKOPHEFIKQKQPKQPQPQRKOQPQRKQLOPPKQPKQPQKQPOPPKNQKOQPKQPQKQPPNOQKGPIQKPOQKPQPQPNPJKQKQPKQMPKPQOPKQNPQPQKQPQKOQPQKPONQQPPQPKKQIQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, focused_energy(3), battle_potion_of_intellect
0:01.222 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.136 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.046 default O moonfire enemy3 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.952 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(6), battle_potion_of_intellect
0:05.103 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:05.885 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:05.885 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:05.885 default I fury_of_elune Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect, ignition_mages_fuse
0:06.639 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord, focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:07.392 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.147 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.900 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.655 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:10.466 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.220 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.974 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.753 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.508 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.262 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.017 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.772 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.527 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.280 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.035 default O moonfire enemy2 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.790 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.544 default R sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.296 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.052 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.807 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.648 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.403 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:24.157 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:24.946 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:25.701 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(5)
0:26.455 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10)
0:27.524 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
0:28.593 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
0:29.662 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3), focused_energy(10)
0:30.417 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), focused_energy(10)
0:31.172 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), focused_energy(10)
0:31.924 default P lunar_strike Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(25), focused_energy(10)
0:33.076 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(23), focused_energy(10)
0:33.851 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10)
0:34.606 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10)
0:35.361 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), focused_energy(10)
0:36.115 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), focused_energy(10)
0:36.984 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10)
0:37.739 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10)
0:38.611 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10)
0:39.364 default L sunfire Fluffy_Pillow 89.0/100: 89% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10)
0:40.119 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10)
0:40.119 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, overwhelming_power(16), focused_energy(10)
0:40.983 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16), focused_energy(10)
0:41.822 default O moonfire enemy3 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15), focused_energy(10)
0:42.886 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), focused_energy(10)
0:44.245 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), focused_energy(10)
0:45.615 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), focused_energy(10)
0:46.695 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), focused_energy(10)
0:47.590 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), focused_energy(10)
0:48.934 default O moonfire enemy2 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), focused_energy(10)
0:49.992 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10)
0:51.346 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), focused_energy(10)
0:52.417 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10)
0:53.332 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), focused_energy(10)
0:54.706 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), focused_energy(10)
0:55.627 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, focused_energy(10)
0:56.715 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
0:57.641 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
0:59.028 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, focused_energy(10)
1:00.660 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(5), torrent_of_elements, focused_energy(10)
1:01.848 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
1:03.315 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), focused_energy(10)
1:04.377 default O moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), focused_energy(10)
1:05.412 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), focused_energy(10)
1:06.736 default I fury_of_elune Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10)
1:07.780 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(20), focused_energy(10)
1:08.668 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2), overwhelming_power(19), focused_energy(10)
1:09.560 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), fury_of_elune, starlord(2), overwhelming_power(18), focused_energy(10)
1:10.614 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10)
1:11.921 default O moonfire enemy3 38.5/100: 39% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10)
1:12.952 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10)
1:13.831 default N sunfire Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(8), fury_of_elune, starlord(3), overwhelming_power(14), focused_energy(10)
1:14.868 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13), focused_energy(10)
1:16.429 default P lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(11), focused_energy(10)
1:17.999 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), focused_energy(10)
1:17.999 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), solar_empowerment, overwhelming_power(10), focused_energy(10)
1:19.144 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(8), focused_energy(10)
1:19.973 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), focused_energy(10)
1:20.950 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), focused_energy(10)
1:21.757 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(6), focused_energy(10)
1:22.713 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10)
1:23.503 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4), focused_energy(10)
1:24.692 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3), focused_energy(10)
1:26.066 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, focused_energy(10)
1:27.151 default O moonfire enemy2 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
1:28.240 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
1:29.167 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:30.553 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(3)
1:31.983 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(3)
1:33.105 default N sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(3)
1:34.227 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(4)
1:35.343 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(4)
1:36.294 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(4)
1:37.717 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(4)
1:38.668 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), solar_empowerment, focused_energy(3)
1:39.708 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), focused_energy(4)
1:40.924 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, focused_energy(5)
1:42.423 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment, starlord, focused_energy(7)
1:43.415 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), starlord, focused_energy(8)
1:45.156 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment, starlord, focused_energy(10)
1:46.308 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:47.734 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), focused_energy(10)
1:48.687 default O moonfire enemy2 25.0/100: 25% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), focused_energy(10)
1:49.808 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), focused_energy(10)
1:50.928 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), focused_energy(10)
1:51.880 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), starlord(2), focused_energy(10)
1:53.001 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:54.390 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), focused_energy(3)
1:55.344 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), starlord(3), focused_energy(3)
1:57.024 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), starlord(3), focused_energy(4)
1:58.141 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), starlord(3), focused_energy(5)
1:59.807 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), solar_empowerment, focused_energy(7)
2:01.010 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(8), conch_of_dark_whispers
2:02.491 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, focused_energy(9), conch_of_dark_whispers
2:03.476 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
2:04.457 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), starlord, focused_energy(10), conch_of_dark_whispers
2:05.611 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers
2:06.440 default G use_items Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers
2:06.440 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:07.376 default I fury_of_elune Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:08.312 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:09.247 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:10.181 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:10.954 default L sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.827 default O moonfire enemy3 36.5/100: 37% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.832 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.837 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:15.115 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.346 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
2:17.577 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
2:18.400 default O moonfire Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(3)
2:19.368 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(4)
2:20.556 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), solar_empowerment, focused_energy(10), ignition_mages_fuse(4)
2:21.572 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), ignition_mages_fuse(4)
2:22.558 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:23.344 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:24.523 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:25.702 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:26.626 default N sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
2:27.716 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
2:28.641 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
2:30.031 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10)
2:30.958 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), focused_energy(10)
2:31.884 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(25), focused_energy(10)
2:32.884 default O moonfire enemy3 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10)
2:33.890 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10)
2:35.172 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(25), focused_energy(10)
2:36.021 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(24), focused_energy(10)
2:37.525 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(23), focused_energy(10)
2:39.033 default P lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(21), focused_energy(10)
2:40.552 default O moonfire Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(20), focused_energy(10)
2:41.570 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), overwhelming_power(19), focused_energy(10)
2:42.680 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), focused_energy(10)
2:44.059 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(16), focused_energy(10)
2:45.151 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), focused_energy(10)
2:46.214 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), focused_energy(10)
2:47.572 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(13), focused_energy(10)
2:48.483 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(12), focused_energy(10)
2:49.850 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(11), focused_energy(10)
2:50.929 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), focused_energy(10)
2:51.707 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), focused_energy(10)
2:52.877 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(8), focused_energy(10)
2:53.662 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, starlord(3), overwhelming_power(7), focused_energy(10)
2:54.587 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), focused_energy(10)
2:55.377 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(5), focused_energy(10)
2:56.562 default O moonfire enemy3 28.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(4), focused_energy(10)
2:57.637 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10)
2:58.554 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(2), focused_energy(10)
2:59.933 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power, focused_energy(10)
3:01.559 default N sunfire Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(3)
3:02.683 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, focused_energy(4)
3:03.901 default O moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, focused_energy(4)
3:05.083 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(24), focused_energy(4)
3:06.465 default H celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(23), focused_energy(4)
3:07.415 default E potion Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(22), focused_energy(3)
3:07.415 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(22), focused_energy(3), battle_potion_of_intellect
3:07.415 default I fury_of_elune Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(22), focused_energy(3), battle_potion_of_intellect
3:08.282 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), focused_energy(5), battle_potion_of_intellect
3:09.146 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(20), focused_energy(6), battle_potion_of_intellect
3:09.901 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), focused_energy(7), battle_potion_of_intellect
3:10.737 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(9), battle_potion_of_intellect
3:11.493 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10), battle_potion_of_intellect
3:12.525 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10), battle_potion_of_intellect
3:13.338 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:14.092 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:15.133 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:15.887 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:16.934 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:17.688 default R sunfire Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:18.513 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:19.343 default O moonfire enemy2 55.5/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:20.176 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:20.957 default P lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:22.126 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:22.913 default R sunfire Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:23.922 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:24.934 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, overwhelming_power(5), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:25.773 default L sunfire Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(4), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:26.764 default O moonfire enemy3 65.5/100: 66% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:27.904 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(2), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:29.362 default P lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:30.830 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:31.985 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:32.937 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
3:34.363 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
3:35.482 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:36.289 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:37.496 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:38.303 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:39.251 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:40.057 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
3:41.265 default O moonfire enemy2 62.5/100: 63% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
3:42.354 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
3:43.741 default P lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
3:45.128 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar, solar_empowerment(2), focused_energy(10)
3:46.315 default N sunfire Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10)
3:47.469 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10)
3:48.449 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
3:49.604 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
3:50.725 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers
3:51.677 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
3:53.104 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
3:54.225 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:55.151 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:56.538 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:57.465 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:58.554 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:59.480 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:00.868 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:02.256 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:03.346 default O moonfire enemy2 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:04.435 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:05.361 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), solar_empowerment, focused_energy(10), conch_of_dark_whispers
4:06.548 default G use_items Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers
4:06.548 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:07.957 default I fury_of_elune Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, focused_energy(10), ignition_mages_fuse
4:09.064 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord, focused_energy(10), ignition_mages_fuse
4:10.004 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment, starlord, focused_energy(10), ignition_mages_fuse
4:11.112 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.428 default O moonfire enemy3 30.0/100: 30% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.387 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.204 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.167 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.322 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.096 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.256 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.035 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.360 default N sunfire Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.249 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.583 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:22.583 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.523 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.279 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(12), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.079 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.833 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(11), focused_energy(10), ignition_mages_fuse(5)
4:26.827 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(10), focused_energy(10)
4:27.767 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), focused_energy(10)
4:28.547 default M moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(8), focused_energy(10)
4:29.468 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(7), focused_energy(10)
4:30.821 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6), focused_energy(10)
4:31.889 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10)
4:33.252 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), focused_energy(10)
4:34.106 default O moonfire enemy3 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10)
4:35.112 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10)
4:36.399 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10)
4:37.414 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), focused_energy(10)
4:38.279 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10)
4:39.299 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10)
4:40.603 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), focused_energy(10)
4:41.477 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10)
4:42.790 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(3), overwhelming_power(15), focused_energy(10)
4:43.749 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(14), focused_energy(10)
4:44.879 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(13), focused_energy(10)
4:45.817 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(12), focused_energy(10)
4:47.225 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(24), focused_energy(10)
4:48.128 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(23), focused_energy(10)
4:49.193 default O moonfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(22), focused_energy(10)
4:50.231 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(21), focused_energy(10)
4:51.116 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), focused_energy(10)
4:52.449 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), focused_energy(10)
4:53.340 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(18), focused_energy(10)
4:54.391 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
4:55.698 default O moonfire enemy3 17.0/100: 17% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10)
4:56.730 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10)
4:57.763 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10)
4:58.616 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
4:59.472 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
5:00.987 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
5:02.505 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
5:03.372 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
5:04.905 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
5:06.023 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
5:07.119 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
5:07.909 default I fury_of_elune Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
5:08.887 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), focused_energy(10), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

life-force : 60768 dps, 37869 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
60768.2 60768.2 58.3 / 0.096% 6267.1 / 10.3% 7574.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 7.9 Astral Power 0.00% 57.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
life-force 60768
Azerite Spike 874 1.4% 16.6 17.42sec 15700 0 Direct 16.6 13238 26494 15717 18.7%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.65 16.63 0.00 0.00 0.0000 0.0000 261372.39 261372.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.52 81.31% 13238.35 12872 14867 13233.39 12872 14171 179007 179007 0.00
crit 3.11 18.69% 26494.16 25743 29734 25348.93 0 29734 82365 82365 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Fury of Elune 2603 4.3% 5.3 60.76sec 145519 143622 Direct 388.3 1689 3375 2001 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 388.31 142.31 0.00 1.0133 0.2961 776993.94 776993.94 0.00 16340.57 143621.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 316.47 81.50% 1689.16 1457 2086 1690.89 1573 1859 534572 534572 0.00
crit 71.84 18.50% 3374.66 2915 4173 3377.88 3133 3724 242422 242422 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 299 (682) 0.5% (1.1%) 8.2 33.54sec 24899 0 Direct 8.2 9184 18369 10891 18.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 89403.56 89403.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 81.39% 9184.00 8921 10304 9184.68 8921 10304 61352 61352 0.00
crit 1.53 18.61% 18369.21 17842 20607 14593.78 0 20607 28052 28052 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 384 0.6% 8.2 33.54sec 14006 0 Direct 24.6 3931 7861 4669 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 24.62 0.00 0.00 0.0000 0.0000 114953.80 114953.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.00 81.23% 3930.80 3823 4416 3930.97 3823 4238 78614 78614 0.00
crit 4.62 18.77% 7861.06 7646 8832 7729.31 0 8832 36340 36340 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 10028 16.5% 84.8 3.49sec 35392 26466 Direct 254.4 9935 19896 11798 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.81 254.42 0.00 0.00 1.3373 0.0000 3001559.14 3001559.14 0.00 26466.21 26466.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 206.85 81.30% 9934.92 3345 25422 9942.07 8996 11077 2054999 2054999 0.00
crit 47.57 18.70% 19896.35 6689 50843 19907.43 14099 26728 946560 946560 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9600 15.8% 27.3 10.91sec 105137 101525 Direct 54.6 3544 7089 4207 18.7%  
Periodic 666.4 3340 6676 3964 18.7% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.31 54.62 666.37 666.37 1.0356 1.3332 2871428.57 2871428.57 0.00 3132.44 101524.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.40 81.28% 3543.56 3280 4695 3544.81 3377 3742 157333 157333 0.00
crit 10.22 18.72% 7088.60 6559 9391 7091.06 6559 7990 72473 72473 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 541.6 81.28% 3339.68 4 4371 3341.23 3264 3474 1808918 1808918 0.00
crit 124.7 18.72% 6675.96 8 8743 6678.89 6430 7107 832706 832706 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2806 (8641) 4.6% (14.2%) 79.5 3.68sec 32514 37248 Direct 80.1 8819 17656 10469 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.51 80.13 0.00 0.00 0.8729 0.0000 838884.53 838884.53 0.00 37247.63 37247.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.16 81.32% 8818.70 7949 11380 8824.03 8495 9290 574660 574660 0.00
crit 14.96 18.68% 17656.06 15898 22760 17671.47 16097 20112 264225 264225 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 5835 9.6% 74.4 3.91sec 23455 0 Direct 223.3 7818 0 7818 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.45 223.34 0.00 0.00 0.0000 0.0000 1746212.51 1746212.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.34 100.00% 7818.43 5962 17070 7822.31 6779 8956 1746213 1746213 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11923.38
  • base_dd_max:11923.38
  • base_dd_mult:1.00
 
Starsurge 13412 22.1% 60.0 5.02sec 66896 64178 Direct 59.8 56591 113186 67119 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.96 59.76 0.00 0.00 1.0424 0.0000 4010878.25 4010878.25 0.00 64178.16 64178.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.65 81.40% 56591.13 51347 73092 56619.10 54531 59144 2753040 2753040 0.00
crit 11.11 18.60% 113186.15 102695 146185 113239.79 102695 127857 1257838 1257838 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5931 9.7% 90.1 3.08sec 19579 0 Direct 90.1 16505 33007 19578 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.08 90.08 0.00 0.00 0.0000 0.0000 1763584.27 1763584.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.30 81.38% 16505.50 16021 18504 16505.47 16021 17428 1209868 1209868 0.00
crit 16.78 18.62% 33007.05 32042 37008 33006.01 32042 35435 553716 553716 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 8997 14.8% 18.1 16.72sec 148262 146056 Direct 18.1 4532 9083 5375 18.5%  
Periodic 669.7 3263 6519 3872 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 669.72 669.72 1.0151 1.3325 2690935.28 2690935.28 0.00 2954.40 146055.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.79 81.47% 4531.87 4112 5887 4532.44 4238 4908 67013 67013 0.00
crit 3.36 18.53% 9082.73 8225 11775 8844.85 0 11775 30544 30544 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 544.3 81.27% 3262.52 14 4268 3264.01 3187 3378 1775817 1775817 0.00
crit 125.4 18.73% 6518.88 26 8537 6521.86 6292 6868 817561 817561 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
life-force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.26sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.15sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8970 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 52.7 45.0sec 5.0sec 93.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.39%
  • arcanic_pulsar_2:11.12%
  • arcanic_pulsar_3:11.42%
  • arcanic_pulsar_4:9.50%
  • arcanic_pulsar_5:13.97%
  • arcanic_pulsar_6:11.40%
  • arcanic_pulsar_7:9.53%
  • arcanic_pulsar_8:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.3sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.2sec 182.2sec 8.12% 7.76% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.71% 34.09% 0.0(0.0) 8.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.7sec 45.3sec 23.65% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.09% 0.00% 84.3(84.3) 5.2

Buff details

  • buff initial source:life-force
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.6 42.5 9.0sec 3.9sec 78.95% 86.03% 1.9(1.9) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.58%
  • lunar_empowerment_2:28.12%
  • lunar_empowerment_3:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.3sec 34.0sec 47.59% 0.00% 3.4(47.9) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.0 49.9 10.9sec 3.9sec 84.74% 92.88% 0.2(0.2) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.40%
  • solar_empowerment_2:38.49%
  • solar_empowerment_3:15.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 44.8 20.4sec 5.0sec 97.13% 92.40% 15.0(15.0) 12.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.23%
  • starlord_2:21.79%
  • starlord_3:59.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.3sec 45.7sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.56%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
life-force
starsurge Astral Power 60.0 2398.3 40.0 40.0 1672.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 80.51 643.71 (27.26%) 8.00 0.36 0.06%
celestial_alignment Astral Power 2.00 80.00 (3.39%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.25 210.56 (8.92%) 2.50 0.07 0.03%
sunfire Astral Power 18.15 54.45 (2.31%) 3.00 0.00 0.00%
moonfire Astral Power 27.31 81.94 (3.47%) 3.00 0.00 0.00%
lunar_strike Astral Power 84.81 1017.29 (43.07%) 12.00 0.40 0.04%
natures_balance Astral Power 399.85 199.91 (8.46%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.16 73.89 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.89 8.01
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.52 0.00 75.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data life-force Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data life-force Damage Per Second
Count 2990
Mean 60768.22
Minimum 55584.38
Maximum 66479.05
Spread ( max - min ) 10894.66
Range [ ( max - min ) / 2 * 100% ] 8.96%
Standard Deviation 1626.4981
5th Percentile 58247.26
95th Percentile 63551.38
( 95th Percentile - 5th Percentile ) 5304.12
Mean Distribution
Standard Deviation 29.7453
95.00% Confidence Intervall ( 60709.92 - 60826.52 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2753
0.1 Scale Factor Error with Delta=300 22584
0.05 Scale Factor Error with Delta=300 90334
0.01 Scale Factor Error with Delta=300 2258348
Priority Target DPS
Sample Data life-force Priority Target Damage Per Second
Count 2990
Mean 37869.35
Minimum 33684.64
Maximum 42538.97
Spread ( max - min ) 8854.33
Range [ ( max - min ) / 2 * 100% ] 11.69%
Standard Deviation 1213.7500
5th Percentile 35988.25
95th Percentile 39975.04
( 95th Percentile - 5th Percentile ) 3986.79
Mean Distribution
Standard Deviation 22.1970
95.00% Confidence Intervall ( 37825.84 - 37912.85 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3947
0.1 Scale Factor Error with Delta=300 12576
0.05 Scale Factor Error with Delta=300 50304
0.01 Scale Factor Error with Delta=300 1257599
DPS(e)
Sample Data life-force Damage Per Second (Effective)
Count 2990
Mean 60768.22
Minimum 55584.38
Maximum 66479.05
Spread ( max - min ) 10894.66
Range [ ( max - min ) / 2 * 100% ] 8.96%
Damage
Sample Data life-force Damage
Count 2990
Mean 18166206.25
Minimum 14316730.81
Maximum 22266652.54
Spread ( max - min ) 7949921.73
Range [ ( max - min ) / 2 * 100% ] 21.88%
DTPS
Sample Data life-force Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data life-force Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data life-force Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data life-force Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data life-force Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data life-force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data life-forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data life-force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.11 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.96 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.04 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.84 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.47 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 85.19 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 79.74 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.53 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQPKQPKQPKNQPQPOQJKOQPKQPKPPPQQPQKNKQPQPQMKKPOPPQKQNPKQPPQQKOPQKIONPKPQQPPPJKQKQKQLOOPKPPPQQPQKKPNQOPKOQPQQKPQPPKNPQGIKQPKQPKOOPPQNQKPKPPQKPOPQKPQNOQPKPQQKPQPOKQPQKQLOPPKPQPHEFIKQKNKOQPKQPQOQKQPQPKPNPKOQPQPMPPKKPQNPQKQPQKOQPPOPGKQNPIQKQKQPKQPOPQQPKNKOQPKPPQQKPPQNOQKOPQKPQQPKPQQNPPPK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask life-force 58.0/100: 58% astral_power
Pre precombat 1 food life-force 58.0/100: 58% astral_power
Pre precombat 2 augmentation life-force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:03.090 default O moonfire enemy3 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:04.015 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:05.192 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:05.998 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:05.998 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:05.998 default I fury_of_elune Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:06.752 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.505 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.260 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.128 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.882 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:10.635 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.390 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.144 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.900 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.656 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.409 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.164 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.918 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.673 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.428 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.183 default O moonfire enemy2 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.938 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.693 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.693 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.448 default O moonfire enemy3 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.202 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.955 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.794 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.550 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
0:24.305 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(5)
0:25.100 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(5)
0:25.853 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(5)
0:26.745 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7)
0:27.832 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6)
0:28.921 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(5)
0:29.675 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(4)
0:30.429 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(3)
0:31.725 default Q solar_wrath Fluffy_Pillow 89.0/100: 89% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(2)
0:32.593 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power
0:33.465 default N sunfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:34.226 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:34.988 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:35.742 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
0:36.711 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
0:37.467 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:38.436 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
0:39.198 default M moonfire Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
0:39.960 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, torrent_of_elements, conch_of_dark_whispers
0:40.913 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
0:41.839 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:43.327 default O moonfire enemy2 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:44.494 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:45.982 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:47.472 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:48.466 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:49.635 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
0:50.603 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:51.739 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:53.186 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
0:54.323 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
0:55.290 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:56.736 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:58.182 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:59.149 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
1:00.115 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(5), torrent_of_elements
1:01.352 default O moonfire enemy3 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:02.555 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:04.086 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment, starlord
1:05.109 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), starlord
1:06.310 default I fury_of_elune Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(24)
1:07.384 default O moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(23)
1:08.461 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(22)
1:09.542 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(21)
1:10.922 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2), overwhelming_power(20)
1:12.011 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
1:13.367 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(17)
1:14.275 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(16)
1:15.186 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15)
1:16.798 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14)
1:18.417 default P lunar_strike Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12)
1:20.048 default J cancel_buff Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(10)
1:20.048 default K starsurge Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar(8), overwhelming_power(10)
1:21.240 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9)
1:22.100 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(8)
1:23.117 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(7)
1:23.959 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(7)
1:24.951 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6)
1:25.773 default L sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(5)
1:26.743 default O moonfire enemy3 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(4)
1:27.863 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(3)
1:28.987 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(2)
1:30.425 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
1:31.562 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:33.007 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:34.454 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:35.902 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3)
1:36.869 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:37.835 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3)
1:39.283 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:40.250 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(3), overwhelming_power(25)
1:41.384 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24)
1:42.487 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
1:43.861 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(22)
1:44.941 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(21)
1:45.863 default O moonfire enemy3 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20)
1:46.950 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19)
1:48.342 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(17)
1:49.439 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16)
1:50.513 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
1:51.428 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
1:52.802 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(13)
1:53.724 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(12)
1:54.648 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(11)
1:55.742 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10)
1:57.139 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(8)
1:58.077 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(7)
1:59.488 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(6)
2:01.154 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), overwhelming_power(4)
2:02.375 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3)
2:03.564 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2)
2:05.084 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:06.108 default G use_items Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), starlord
2:06.108 default I fury_of_elune Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), starlord, ignition_mages_fuse
2:07.460 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), fury_of_elune, starlord, ignition_mages_fuse
2:08.614 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse
2:09.441 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(2), ignition_mages_fuse
2:10.681 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), ignition_mages_fuse(2)
2:11.615 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:12.388 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:13.542 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), ignition_mages_fuse(2)
2:14.452 default O moonfire enemy2 19.5/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:15.455 default O moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:16.459 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:17.736 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:19.015 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.836 default N sunfire Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.804 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.625 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(2), lunar_empowerment, conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.680 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.934 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.919 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.138 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:27.626 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:28.621 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
2:29.789 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:31.238 default O moonfire enemy2 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:32.374 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:33.823 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
2:34.790 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
2:35.927 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:37.375 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements
2:38.342 default N sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
2:39.480 default O moonfire enemy3 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
2:40.618 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
2:41.501 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(24)
2:43.063 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), solar_empowerment, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
2:44.208 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
2:45.631 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
2:46.583 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
2:47.538 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), starlord, torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
2:48.664 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(17), conch_of_dark_whispers
2:50.063 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(15), conch_of_dark_whispers
2:51.003 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(14), conch_of_dark_whispers
2:52.667 default O moonfire enemy2 39.0/100: 39% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(13), conch_of_dark_whispers
2:53.782 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers
2:54.901 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
2:55.708 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
2:56.921 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
2:57.735 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
2:58.695 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7)
2:59.514 default L sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(6)
3:00.480 default O moonfire enemy3 18.0/100: 18% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(5)
3:01.596 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(4)
3:03.022 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, starlord(3), overwhelming_power(2)
3:04.713 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, overwhelming_power
3:05.947 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
3:07.479 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), solar_empowerment, starlord
3:08.501 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), starlord
3:10.302 default H celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), celestial_alignment, starlord
3:11.347 default E potion Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, starlord
3:11.347 default F berserking Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, starlord, battle_potion_of_intellect
3:11.347 default I fury_of_elune Fluffy_Pillow 84.5/100: 85% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord, battle_potion_of_intellect
3:12.299 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, starlord, battle_potion_of_intellect
3:13.251 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect
3:14.037 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), battle_potion_of_intellect
3:14.963 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.864 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.762 default O moonfire enemy2 4.0/100: 4% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.662 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:18.426 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.570 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.469 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:21.232 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:22.377 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:23.141 default O moonfire Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:24.040 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:25.028 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), conch_of_dark_whispers, battle_potion_of_intellect
3:26.105 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:26.993 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:28.325 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:29.213 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, battle_potion_of_intellect
3:30.544 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord, battle_potion_of_intellect
3:31.746 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:33.236 default N sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:34.404 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:35.892 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect
3:37.060 default O moonfire enemy2 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:38.047 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24)
3:38.819 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24)
3:39.975 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23)
3:40.749 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
3:41.915 default M moonfire Fluffy_Pillow 59.5/100: 60% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
3:42.831 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
3:44.178 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power starlord(3), torrent_of_elements, overwhelming_power(25)
3:45.735 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power torrent_of_elements, overwhelming_power(24)
3:46.871 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23)
3:47.977 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22)
3:49.351 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(20)
3:50.276 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19)
3:51.368 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18)
3:52.764 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(17)
3:53.698 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16)
3:54.801 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15)
3:55.717 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
3:57.092 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12)
3:58.016 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
3:59.107 default O moonfire enemy3 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10)
4:00.202 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9)
4:01.137 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(8)
4:02.542 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
4:03.952 default O moonfire enemy2 47.5/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
4:05.064 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
4:06.492 default G use_items Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(3)
4:06.492 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(3), ignition_mages_fuse
4:07.665 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(2), ignition_mages_fuse
4:08.638 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power, ignition_mages_fuse
4:09.785 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse
4:11.250 default I fury_of_elune Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, ignition_mages_fuse(2)
4:12.452 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), fury_of_elune, solar_empowerment(3), starlord, ignition_mages_fuse(2)
4:13.391 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(5), fury_of_elune, solar_empowerment(2), starlord, ignition_mages_fuse(2)
4:14.497 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), ignition_mages_fuse(3)
4:15.373 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
4:16.407 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:17.260 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:18.538 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:19.503 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
4:20.325 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:21.556 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:22.522 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:23.708 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:24.499 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), ignition_mages_fuse(5)
4:25.291 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), starlord(3), ignition_mages_fuse(5)
4:26.685 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8)
4:27.923 default N sunfire Fluffy_Pillow 52.5/100: 53% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
4:28.969 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
4:30.013 default O moonfire enemy2 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:31.030 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:31.896 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
4:33.191 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
4:34.207 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:35.654 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
4:37.102 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
4:38.069 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
4:39.035 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3)
4:40.171 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3)
4:41.618 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
4:43.065 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
4:44.034 default N sunfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
4:45.171 default O moonfire enemy3 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
4:46.307 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
4:47.273 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3)
4:48.513 default O moonfire enemy2 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
4:49.716 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24)
4:51.119 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, overwhelming_power(22)
4:52.064 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(21)
4:53.180 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20)
4:54.565 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(19)
4:55.492 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(18)
4:56.422 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(17)
4:57.822 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(16)
4:58.926 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
5:00.298 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(13)
5:01.218 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(12)
5:02.144 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(11), conch_of_dark_whispers
5:03.235 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(10), conch_of_dark_whispers
5:04.876 default P lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(9), conch_of_dark_whispers
5:06.524 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(7), conch_of_dark_whispers
5:08.182 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), overwhelming_power(5), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="life-force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

lucid dreams : 61591 dps, 38849 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
61591.3 61591.3 61.5 / 0.100% 6739.5 / 10.9% 7171.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.5 Astral Power 0.00% 58.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 61591
Fury of Elune 2708 4.4% 5.3 60.80sec 151612 155116 Direct 401.4 1698 3392 2013 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 401.45 143.07 0.00 0.9775 0.2941 808312.01 808312.01 0.00 17091.58 155116.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.72 81.39% 1698.12 1457 2071 1699.96 1607 1851 554833 554833 0.00
crit 74.72 18.61% 3392.34 2915 4142 3395.78 3104 3767 253479 253479 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 300 (686) 0.5% (1.1%) 8.2 32.98sec 24985 0 Direct 8.2 9213 18414 10931 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 89743.51 89743.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 81.33% 9213.49 8921 10228 9212.19 8921 10090 61519 61519 0.00
crit 1.53 18.67% 18414.20 17842 20456 14559.43 0 20456 28225 28225 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 386 0.6% 8.2 32.98sec 14054 0 Direct 24.6 3948 7896 4684 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 24.63 0.00 0.00 0.0000 0.0000 115375.18 115375.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.04 81.35% 3948.19 3823 4384 3948.12 3823 4265 79105 79105 0.00
crit 4.59 18.65% 7895.71 7646 8767 7755.65 0 8767 36271 36271 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 10034 16.3% 82.3 3.59sec 36494 27665 Direct 246.8 10243 20462 12164 18.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.28 246.83 0.00 0.00 1.3191 0.0000 3002603.13 3002603.13 0.00 27665.09 27665.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 200.42 81.20% 10242.97 3345 25236 10250.23 9189 11350 2052890 2052890 0.00
crit 46.41 18.80% 20462.14 6689 50471 20478.69 15320 26029 949714 949714 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9687 15.7% 27.6 10.82sec 105063 101494 Direct 55.2 3555 7107 4216 18.6%  
Periodic 667.3 3362 6722 3994 18.8% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.58 55.16 667.33 667.33 1.0352 1.3310 2897658.77 2897658.77 0.00 3160.68 101494.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.90 81.40% 3554.80 3280 4661 3556.04 3386 3757 159615 159615 0.00
crit 10.26 18.60% 7106.75 6559 9322 7110.63 6559 8275 72907 72907 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 541.9 81.20% 3362.05 7 4339 3363.69 3273 3513 1821768 1821768 0.00
crit 125.5 18.80% 6721.71 20 8679 6724.45 6423 7072 843368 843368 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2848 (8929) 4.6% (14.5%) 80.3 3.64sec 33264 38063 Direct 81.0 8856 17715 10520 18.8%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.32 80.97 0.00 0.00 0.8739 0.0000 851754.81 851754.81 0.00 38062.69 38062.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.77 81.23% 8856.07 7949 11297 8861.05 8524 9358 582459 582459 0.00
crit 15.20 18.77% 17714.53 15898 22594 17721.40 15898 21480 269296 269296 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 6082 9.9% 77.0 3.77sec 23625 0 Direct 231.1 7875 0 7875 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.04 231.11 0.00 0.00 0.0000 0.0000 1819941.25 1819941.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 231.11 100.00% 7875.17 5962 16945 7878.28 6988 9160 1819941 1819941 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11923.38
  • base_dd_max:11923.38
  • base_dd_mult:1.00
 
Starsurge 14377 23.3% 64.2 4.70sec 66980 64431 Direct 63.9 56681 113348 67258 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.18 63.92 0.00 0.00 1.0396 0.0000 4298819.93 4298819.93 0.00 64430.75 64430.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.99 81.34% 56681.25 51347 72557 56707.81 54832 59576 2946941 2946941 0.00
crit 11.93 18.66% 113348.36 102695 145115 113356.59 102695 130126 1351879 1351879 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6098 9.9% 92.2 3.05sec 19686 0 Direct 92.2 16585 33185 19685 18.7%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.15 92.15 0.00 0.00 0.0000 0.0000 1814081.45 1814081.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.94 81.33% 16585.44 16021 18369 16585.87 16043 17387 1243001 1243001 0.00
crit 17.21 18.67% 33185.49 32042 36737 33183.43 32042 35759 571080 571080 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 9072 14.7% 18.2 16.69sec 149388 147749 Direct 18.2 4575 9153 5432 18.7%  
Periodic 670.7 3283 6563 3898 18.8% 297.8%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.16 18.16 670.67 670.67 1.0111 1.3299 2713269.14 2713269.14 0.00 2980.71 147749.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.76 81.28% 4574.70 4112 5844 4575.49 4258 4986 67540 67540 0.00
crit 3.40 18.72% 9152.51 8225 11689 8905.07 0 11689 31113 31113 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 544.8 81.23% 3282.70 4 4237 3284.24 3204 3427 1788379 1788379 0.00
crit 125.9 18.77% 6563.38 38 8474 6565.84 6302 6968 826237 826237 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.72sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.52sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8979 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.5 56.4 42.4sec 4.7sec 92.96% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.60%
  • arcanic_pulsar_2:11.31%
  • arcanic_pulsar_3:11.08%
  • arcanic_pulsar_4:10.86%
  • arcanic_pulsar_5:12.23%
  • arcanic_pulsar_6:11.01%
  • arcanic_pulsar_7:11.36%
  • arcanic_pulsar_8:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.0sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.12% 7.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 7.8 0.0 40.0sec 40.0sec 26.62% 34.81% 0.0(0.0) 7.6

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.2sec 23.82% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.07% 0.00% 84.1(84.1) 5.2

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.14% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 7.7 1.9 36.4sec 28.4sec 22.86% 0.00% 1.9(1.9) 7.4

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:376.75

Stack Uptimes

  • lucid_dreams_1:22.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 26.1 54.4 11.5sec 3.7sec 86.13% 92.02% 3.0(3.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:30.03%
  • lunar_empowerment_2:38.02%
  • lunar_empowerment_3:18.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 63.8sec 33.5sec 48.44% 0.00% 3.5(49.1) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.39%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.47%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.69%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.84%
  • overwhelming_power_12:1.89%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.19%
  • overwhelming_power_18:2.25%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.39%
  • overwhelming_power_21:2.47%
  • overwhelming_power_22:2.54%
  • overwhelming_power_23:2.62%
  • overwhelming_power_24:2.69%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 19.0 61.5 14.9sec 3.7sec 90.41% 95.12% 0.9(0.9) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:22.09%
  • solar_empowerment_2:43.40%
  • solar_empowerment_3:24.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 48.8 20.1sec 4.7sec 97.54% 92.77% 18.5(18.5) 10.5

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.58%
  • starlord_2:22.56%
  • starlord_3:59.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.7sec 45.7sec 23.65% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 64.2 2567.2 40.0 40.0 1674.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 81.32 649.12 (25.62%) 7.98 1.40 0.22%
celestial_alignment Astral Power 2.00 80.00 (3.16%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.14 210.23 (8.30%) 2.50 0.11 0.05%
sunfire Astral Power 18.16 54.49 (2.15%) 3.00 0.00 0.00%
moonfire Astral Power 27.58 82.74 (3.27%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.28 984.70 (38.87%) 11.97 2.67 0.27%
lucid_dreams Astral Power 9.63 192.59 (7.60%) 20.00 0.00 0.00%
natures_balance Astral Power 399.85 199.89 (7.89%) 0.50 0.03 0.02%
arcanic_pulsar Astral Power 6.65 79.79 (3.15%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.46 8.57
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 23.09 0.00 80.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data lucid dreams Damage Per Second
Count 2990
Mean 61591.34
Minimum 56704.88
Maximum 68208.81
Spread ( max - min ) 11503.94
Range [ ( max - min ) / 2 * 100% ] 9.34%
Standard Deviation 1715.5458
5th Percentile 58851.43
95th Percentile 64525.72
( 95th Percentile - 5th Percentile ) 5674.28
Mean Distribution
Standard Deviation 31.3738
95.00% Confidence Intervall ( 61529.85 - 61652.84 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 2981
0.1 Scale Factor Error with Delta=300 25124
0.05 Scale Factor Error with Delta=300 100496
0.01 Scale Factor Error with Delta=300 2512398
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 2990
Mean 38849.35
Minimum 34990.66
Maximum 43780.29
Spread ( max - min ) 8789.63
Range [ ( max - min ) / 2 * 100% ] 11.31%
Standard Deviation 1287.6120
5th Percentile 36823.24
95th Percentile 41052.40
( 95th Percentile - 5th Percentile ) 4229.16
Mean Distribution
Standard Deviation 23.5478
95.00% Confidence Intervall ( 38803.20 - 38895.50 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4220
0.1 Scale Factor Error with Delta=300 14154
0.05 Scale Factor Error with Delta=300 56613
0.01 Scale Factor Error with Delta=300 1415317
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 2990
Mean 61591.34
Minimum 56704.88
Maximum 68208.81
Spread ( max - min ) 11503.94
Range [ ( max - min ) / 2 * 100% ] 9.34%
Damage
Sample Data lucid dreams Damage
Count 2990
Mean 18411559.17
Minimum 14395594.96
Maximum 22784436.07
Spread ( max - min ) 8388841.11
Range [ ( max - min ) / 2 * 100% ] 22.78%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.33 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.92 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 64.18 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.34 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.01 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.29 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 25.57 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 82.56 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 80.52 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.54 sunfire

Sample Sequence

012345678ACDKKNOOPPHFGIKQKQPKQPKNQPQOQKOQPKQPKQPKQPQPKLPPQQPPPKKOOPPKQPNQQKPQPQKPKOOPIKNQPQPKPPQJKPKQOONPQKQPKQPPQKQPKNQOOPQKPPQQPPKQKQPKLGIPOOKPKQPPQQNKPKQPQPKQPOOKQPQNQPKQPKQPMPKPQPKNOPQQKPQPHEFIKOKQPNQKQPQPOQKQPKQPKQPQKNOPPPQQOKKPPQKNQPKQPKOQPPQKKOGQPIQKNQPKQPKOQPPQKQNOKQPPQKPPQKQPOQNQKPOPQKQKQPQPKPNQQOPK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lucid_dreams, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default N sunfire Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:03.064 default O moonfire Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:03.964 default O moonfire enemy2 14.5/100: 14% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:04.865 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.012 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:07.156 default H celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:07.941 default F berserking Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:07.941 default G use_items Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:07.941 default I fury_of_elune Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.696 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.449 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.204 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.956 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.709 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.554 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.309 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.063 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.817 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.573 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.328 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.083 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.837 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.592 default O moonfire enemy3 70.0/100: 70% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.348 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.104 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.860 default O moonfire enemy2 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.615 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.370 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.183 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(4)
0:23.940 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(4)
0:24.695 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.464 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.218 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.972 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(5)
0:27.726 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
0:28.481 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:29.236 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:30.153 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:30.908 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:31.829 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:32.584 default L sunfire Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:33.339 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:34.409 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:35.482 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(9)
0:36.235 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(8)
0:36.989 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(8)
0:38.073 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(2), starlord(3), overwhelming_power(6)
0:39.354 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(2), starlord(3), overwhelming_power(5)
0:40.641 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(2), overwhelming_power(4)
0:41.584 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3)
0:42.772 default O moonfire enemy2 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2)
0:43.930 default O moonfire enemy3 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power
0:45.094 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:46.583 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
0:48.073 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
0:49.242 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
0:50.209 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:51.656 default N sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
0:52.792 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
0:53.757 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
0:54.722 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord(3)
0:55.859 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
0:57.308 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(25)
0:58.191 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(24)
0:59.752 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
1:00.641 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment, torrent_of_elements, overwhelming_power(22)
1:01.786 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21)
1:03.207 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24)
1:04.311 default O moonfire enemy3 26.5/100: 27% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
1:05.388 default O moonfire enemy2 30.5/100: 31% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22)
1:06.466 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21)
1:07.846 default I fury_of_elune Fluffy_Pillow 47.0/100: 47% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
1:09.028 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power lucid_dreams, arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18)
1:10.122 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power lucid_dreams, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17)
1:11.051 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power lucid_dreams, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16)
1:11.844 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
1:13.033 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
1:13.831 default P lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14)
1:15.027 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12)
1:15.974 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
1:17.359 default P lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10)
1:18.755 default Q solar_wrath Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9)
1:19.690 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8)
1:19.690 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(8)
1:20.891 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(7)
1:22.384 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(5)
1:23.564 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(4)
1:24.543 default O moonfire enemy3 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3)
1:25.700 default O moonfire enemy2 47.0/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2)
1:26.859 default N sunfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power
1:28.024 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:29.512 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2)
1:30.506 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
1:31.674 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:32.642 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:34.088 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
1:35.227 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:36.194 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:37.642 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
1:39.089 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3)
1:40.055 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(5), solar_empowerment(2)
1:41.293 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord
1:42.314 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:43.846 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, torrent_of_elements
1:45.049 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:46.217 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:47.210 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:48.379 default O moonfire enemy2 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:49.547 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:51.037 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements
1:52.031 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:53.198 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:54.645 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:56.091 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
1:56.974 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
1:57.857 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(24)
1:59.420 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22)
2:00.991 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), overwhelming_power(21)
2:02.139 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19)
2:02.970 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(19)
2:03.947 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18)
2:04.756 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(17)
2:05.971 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(16)
2:06.928 default L sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15)
2:07.866 default G use_items Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14)
2:07.866 default I fury_of_elune Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), ignition_mages_fuse
2:08.977 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), ignition_mages_fuse
2:10.300 default O moonfire enemy2 28.5/100: 28% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), ignition_mages_fuse
2:11.347 default O moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse
2:12.397 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.409 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power lucid_dreams, arcanic_pulsar(3), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.702 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power lucid_dreams, arcanic_pulsar(3), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse(2)
2:15.722 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power lucid_dreams, arcanic_pulsar(4), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers, ignition_mages_fuse(2)
2:16.592 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.851 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:19.111 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power lucid_dreams, arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(3)
2:19.960 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power lucid_dreams, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.777 default N sunfire Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.741 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(4), solar_empowerment, conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.793 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse(4)
2:24.094 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.008 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.766 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), ignition_mages_fuse(5)
2:26.901 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(23), ignition_mages_fuse(5)
2:27.662 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), ignition_mages_fuse(5)
2:28.805 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(21)
2:29.891 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20)
2:30.790 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
2:32.142 default O moonfire enemy2 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(17)
2:33.212 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
2:34.285 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
2:35.363 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14)
2:36.282 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
2:37.663 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
2:38.587 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11)
2:39.678 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10)
2:40.611 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(9)
2:42.257 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(7)
2:43.463 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(6)
2:44.335 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(5)
2:45.643 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, starlord, torrent_of_elements, overwhelming_power(4)
2:46.674 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(3)
2:47.530 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(2)
2:48.815 default M moonfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power
2:49.828 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord(2)
2:51.581 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starlord(2)
2:52.748 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
2:54.198 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
2:55.166 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3)
2:56.613 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), starlord(3)
2:57.750 default N sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3)
2:58.887 default O moonfire enemy2 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3)
3:00.023 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:01.471 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:02.436 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), solar_empowerment, torrent_of_elements
3:03.489 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), torrent_of_elements
3:04.727 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:06.259 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, torrent_of_elements
3:07.282 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:08.813 default H celestial_alignment Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, torrent_of_elements
3:09.859 default E potion Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, torrent_of_elements
3:09.859 default F berserking Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
3:09.859 default I fury_of_elune Fluffy_Pillow 81.5/100: 82% astral_power berserking, arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
3:10.811 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
3:11.763 default O moonfire Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:12.689 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:13.612 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:14.376 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:15.519 default N sunfire Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:16.419 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:17.183 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:18.082 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:18.846 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:19.992 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:20.756 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:21.900 default O moonfire enemy3 83.5/100: 84% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:22.889 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:23.729 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:24.807 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:25.697 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:27.028 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:28.076 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:28.942 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:30.238 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:31.256 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:32.095 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:33.353 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:34.192 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:35.181 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
3:36.224 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:37.271 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
3:38.608 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
3:39.949 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
3:41.296 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
3:42.202 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(17)
3:43.111 default O moonfire enemy3 86.5/100: 87% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(16)
3:44.183 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(15)
3:45.356 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14)
3:46.499 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(13)
3:47.918 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12)
3:49.343 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(24)
3:50.253 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23)
3:51.328 default N sunfire Fluffy_Pillow 47.0/100: 47% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22)
3:52.376 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21)
3:53.272 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
3:54.619 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
3:55.680 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
3:56.587 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17)
3:57.946 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
3:59.019 default O moonfire enemy2 35.0/100: 35% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14)
4:00.098 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13)
4:01.021 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
4:02.406 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
4:03.798 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power lucid_dreams, arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(10)
4:04.730 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power lucid_dreams, arcanic_pulsar(7), solar_empowerment, overwhelming_power(9)
4:05.930 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(8)
4:07.096 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(6)
4:08.090 default G use_items Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(5)
4:08.090 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(5), ignition_mages_fuse
4:08.904 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(5), ignition_mages_fuse
4:10.122 default I fury_of_elune Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(3), ignition_mages_fuse
4:11.085 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(2), ignition_mages_fuse
4:11.907 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), ignition_mages_fuse
4:12.874 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, ignition_mages_fuse(2)
4:13.914 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
4:14.802 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:16.133 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:17.137 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:17.991 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:19.272 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:20.277 default O moonfire enemy2 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.243 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.063 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.294 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:24.525 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.318 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), solar_empowerment(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.333 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.171 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse(5)
4:28.158 default O moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
4:29.361 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
4:30.564 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
4:31.556 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers
4:32.918 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
4:34.284 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(22)
4:35.201 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(21)
4:36.284 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
4:37.632 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
4:38.984 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(18)
4:39.890 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(17)
4:40.960 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16)
4:41.872 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
4:43.242 default O moonfire enemy3 22.5/100: 23% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(13)
4:44.326 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(12)
4:45.250 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(11)
4:46.340 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), solar_empowerment, overwhelming_power(10)
4:47.354 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, torrent_of_elements, overwhelming_power(9)
4:48.554 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8)
4:50.042 default O moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(6)
4:51.220 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(5)
4:52.724 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25)
4:53.657 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, overwhelming_power(24)
4:54.762 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23)
4:55.558 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22)
4:56.497 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
4:57.277 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
4:58.449 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
4:59.372 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
5:00.550 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power lucid_dreams, arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
5:01.618 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
5:02.983 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(15)
5:04.060 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
5:04.980 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
5:05.901 default O moonfire enemy2 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
5:06.989 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
5:08.381 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(2), overwhelming_power(9), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

purification protocol : 61808 dps, 38066 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
61807.6 61807.6 59.5 / 0.096% 6572.4 / 10.6% 7701.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 7.9 Astral Power 0.00% 57.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 61808
Fury of Elune 2590 4.2% 5.3 60.78sec 144833 143015 Direct 388.4 1681 3356 1991 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 388.39 142.27 0.00 1.0127 0.2962 773137.09 773137.09 0.00 16261.17 143014.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 316.60 81.51% 1680.98 1457 1987 1682.66 1585 1841 532190 532190 0.00
crit 71.80 18.49% 3356.02 2915 3974 3359.79 3098 3708 240947 240947 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 298 (682) 0.5% (1.1%) 8.2 33.36sec 24794 0 Direct 8.2 9127 18277 10846 18.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 89372.23 89372.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.22% 9126.95 8921 9813 9124.88 8921 9813 61087 61087 0.00
crit 1.55 18.78% 18277.15 17842 19626 14395.70 0 19626 28285 28285 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 384 0.6% 8.2 33.36sec 13949 0 Direct 24.7 3913 7823 4649 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 24.72 0.00 0.00 0.0000 0.0000 114943.35 114943.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.06 81.16% 3912.71 3823 4206 3912.10 3823 4206 78505 78505 0.00
crit 4.66 18.84% 7823.05 7646 8411 7686.45 0 8411 36438 36438 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 9972 16.2% 84.8 3.49sec 35183 26311 Direct 254.5 9887 19727 11727 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.82 254.46 0.00 0.00 1.3372 0.0000 2984256.79 2984256.79 0.00 26310.63 26310.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 206.85 81.29% 9886.61 3345 24211 9893.47 9086 10870 2045160 2045160 0.00
crit 47.61 18.71% 19726.63 6689 48422 19737.42 14318 25968 939097 939097 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9550 15.5% 27.3 10.91sec 104599 100994 Direct 54.6 3524 7042 4175 18.5%  
Periodic 666.4 3323 6641 3944 18.7% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.31 54.62 666.43 666.43 1.0357 1.3330 2856401.24 2856401.24 0.00 3116.19 100993.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.51 81.49% 3524.06 3280 4472 3525.12 3368 3744 156849 156849 0.00
crit 10.11 18.51% 7042.41 6559 8943 7044.19 6559 8319 71184 71184 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 541.7 81.28% 3322.87 2 4163 3324.33 3246 3473 1800012 1800012 0.00
crit 124.7 18.72% 6641.11 25 8327 6643.66 6376 6983 828356 828356 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 2228 3.6% 16.7 17.09sec 39961 0 Direct 50.1 11226 22460 13320 18.6%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.70 50.11 0.00 0.00 0.0000 0.0000 667462.14 667462.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.77 81.36% 11226.49 10972 12069 11225.22 10972 11795 457717 457717 0.00
crit 9.34 18.64% 22460.15 21944 24139 22458.18 21944 24139 209745 209745 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9969.52
  • base_dd_max:9969.52
  • base_dd_mult:1.00
 
Solar Wrath 2790 (8602) 4.5% (13.9%) 79.5 3.66sec 32351 37079 Direct 80.2 8771 17531 10407 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.55 80.17 0.00 0.00 0.8725 0.0000 834307.43 834307.43 0.00 37078.59 37078.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.21 81.33% 8770.72 7949 10838 8775.58 8488 9236 571911 571911 0.00
crit 14.97 18.67% 17531.10 15898 21676 17540.09 16057 19277 262396 262396 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 5811 9.4% 74.6 3.89sec 23321 0 Direct 223.7 7774 0 7774 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.57 223.72 0.00 0.00 0.0000 0.0000 1739169.47 1739169.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.72 100.00% 7774.19 5962 16257 7776.53 6846 9264 1739169 1739169 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13347 21.6% 60.0 5.01sec 66544 63860 Direct 59.8 56272 112362 66774 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.98 59.77 0.00 0.00 1.0420 0.0000 3991169.74 3991169.74 0.00 63859.74 63859.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.58 81.27% 56271.61 51347 69612 56298.79 54402 58512 2733459 2733459 0.00
crit 11.19 18.73% 112362.36 102695 139223 112428.82 102695 130786 1257710 1257710 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5886 9.5% 90.1 3.08sec 19428 0 Direct 90.1 16392 32789 19427 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.09 90.09 0.00 0.00 0.0000 0.0000 1750241.00 1750241.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.41 81.49% 16392.39 16021 17623 16391.82 16021 17248 1203435 1203435 0.00
crit 16.68 18.51% 32789.19 32042 35246 32790.03 32042 34925 546806 546806 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 8949 14.5% 18.2 16.70sec 147299 145260 Direct 18.2 4508 9008 5341 18.5%  
Periodic 669.8 3245 6487 3851 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.17 18.17 669.82 669.82 1.0141 1.3323 2676558.45 2676558.45 0.00 2938.62 145259.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.81 81.50% 4507.81 4112 5607 4508.63 4215 4823 66756 66756 0.00
crit 3.36 18.50% 9008.16 8225 11214 8774.50 0 11214 30287 30287 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 544.6 81.31% 3245.10 13 4065 3246.54 3175 3387 1767331 1767331 0.00
crit 125.2 18.69% 6486.59 39 8130 6489.18 6233 6854 812185 812185 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.41sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.09sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8982 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 52.7 45.0sec 5.0sec 93.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.35%
  • arcanic_pulsar_2:11.16%
  • arcanic_pulsar_3:11.44%
  • arcanic_pulsar_4:9.50%
  • arcanic_pulsar_5:13.90%
  • arcanic_pulsar_6:11.40%
  • arcanic_pulsar_7:9.53%
  • arcanic_pulsar_8:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.3sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.3sec 182.3sec 8.12% 7.66% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.72% 34.10% 0.0(0.0) 8.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.0sec 23.77% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.08% 0.00% 84.3(84.3) 5.2

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.8 42.3 9.0sec 3.9sec 78.88% 86.05% 1.9(1.9) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.68%
  • lunar_empowerment_2:27.86%
  • lunar_empowerment_3:14.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.5 64.4sec 33.5sec 47.95% 0.00% 3.5(49.1) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.2 49.8 10.9sec 3.9sec 84.72% 92.98% 0.2(0.2) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.55%
  • solar_empowerment_2:38.53%
  • solar_empowerment_3:15.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 44.8 20.4sec 5.0sec 97.13% 92.46% 15.0(15.0) 12.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.28%
  • starlord_2:21.71%
  • starlord_3:59.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.7sec 45.4sec 23.61% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.0 2399.1 40.0 40.0 1663.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 80.55 644.06 (27.26%) 8.00 0.33 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.39%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.24 210.55 (8.91%) 2.50 0.06 0.03%
sunfire Astral Power 18.17 54.51 (2.31%) 3.00 0.00 0.00%
moonfire Astral Power 27.31 81.92 (3.47%) 3.00 0.00 0.00%
lunar_strike Astral Power 84.82 1017.47 (43.07%) 12.00 0.40 0.04%
natures_balance Astral Power 399.85 199.91 (8.46%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.16 73.87 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.89 8.01
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.47 0.00 69.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data purification protocol Damage Per Second
Count 2990
Mean 61807.63
Minimum 56904.16
Maximum 67922.05
Spread ( max - min ) 11017.89
Range [ ( max - min ) / 2 * 100% ] 8.91%
Standard Deviation 1660.4648
5th Percentile 59145.63
95th Percentile 64594.38
( 95th Percentile - 5th Percentile ) 5448.75
Mean Distribution
Standard Deviation 30.3665
95.00% Confidence Intervall ( 61748.11 - 61867.14 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2773
0.1 Scale Factor Error with Delta=300 23537
0.05 Scale Factor Error with Delta=300 94147
0.01 Scale Factor Error with Delta=300 2353657
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 2990
Mean 38065.60
Minimum 34861.77
Maximum 42023.92
Spread ( max - min ) 7162.14
Range [ ( max - min ) / 2 * 100% ] 9.41%
Standard Deviation 1176.6344
5th Percentile 36194.46
95th Percentile 40024.37
( 95th Percentile - 5th Percentile ) 3829.91
Mean Distribution
Standard Deviation 21.5182
95.00% Confidence Intervall ( 38023.42 - 38107.77 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3671
0.1 Scale Factor Error with Delta=300 11819
0.05 Scale Factor Error with Delta=300 47275
0.01 Scale Factor Error with Delta=300 1181863
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 2990
Mean 61807.63
Minimum 56904.16
Maximum 67922.05
Spread ( max - min ) 11017.89
Range [ ( max - min ) / 2 * 100% ] 8.91%
Damage
Sample Data purification protocol Damage
Count 2990
Mean 18477018.94
Minimum 14589543.13
Maximum 22527666.52
Spread ( max - min ) 7938123.39
Range [ ( max - min ) / 2 * 100% ] 21.48%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.11 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.98 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.04 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.80 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.50 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 85.19 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 79.78 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.55 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQKQPKQPNQPQPOQRKQKQPKLOPPQPQPPKQPQKQPQKKONPPPOQKQPQKQPPQKNOPIKQPKOQPQQPPJKNKQPKMOQPQKQPQPNQQPKKPPQKOOPQQKNPQPQKPQGIPKQKQPKQMNOPPQPPKKPPQKQNPOQKPQQOPQPKPKNQPQKQPQKQMOPQPHEFKIKNQPKQPKQPKOQPQPQPLOKKQPQPKQPKQPMPQNQPPKKOPPQKPQQPKNOPGQPIKPKOPKQPNQPQQPPKOQPQKLKPOPQKQPPKQPPONQKQKQOPPQKPQQQKP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.090 default O moonfire enemy2 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.015 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.193 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.999 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.999 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.999 default I fury_of_elune Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.752 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:07.509 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.264 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.018 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.772 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.525 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.280 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.090 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.844 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.598 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.409 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.165 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.919 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.696 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.451 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.229 default O moonfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.983 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.738 default R sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.492 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.244 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.998 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.751 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.505 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.320 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.074 default L sunfire Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.829 default O moonfire enemy3 8.0/100: 8% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.584 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:27.698 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:28.810 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:29.564 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
0:30.678 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
0:31.432 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:32.744 default P lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:34.053 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:34.929 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
0:35.684 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:36.651 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
0:37.406 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:38.167 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:38.923 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:39.894 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:40.648 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment
0:41.477 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:42.678 default O moonfire enemy2 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:43.847 default N sunfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(24)
0:44.920 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(23)
0:46.290 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21)
0:47.671 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20)
0:49.054 default O moonfire Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2), overwhelming_power(18)
0:50.149 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2), overwhelming_power(17)
0:51.081 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
0:52.183 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15)
0:53.098 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
0:54.472 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13)
0:55.395 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
0:56.484 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
0:57.413 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
0:58.807 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
1:00.208 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(7)
1:01.150 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(6)
1:02.362 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(5)
1:03.541 default O moonfire enemy2 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4)
1:04.728 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(3)
1:06.243 default I fury_of_elune Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power
1:07.442 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord
1:08.645 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2)
1:09.639 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2)
1:11.128 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2)
1:12.297 default O moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3)
1:13.433 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25)
1:14.317 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
1:15.646 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(23)
1:16.535 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(22)
1:17.429 default P lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21)
1:19.006 default P lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19)
1:20.594 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18)
1:20.594 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), overwhelming_power(18)
1:21.755 default N sunfire Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17)
1:22.738 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25)
1:23.696 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
1:24.488 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23)
1:25.681 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22)
1:26.619 default M moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21)
1:27.536 default O moonfire enemy3 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
1:28.594 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19)
1:29.494 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
1:30.851 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17)
1:31.761 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
1:32.834 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15)
1:33.750 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
1:35.125 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12)
1:36.051 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
1:37.443 default N sunfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(10)
1:38.540 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(9)
1:39.476 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(8)
1:40.415 default P lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(7)
1:42.075 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(3), overwhelming_power(5)
1:43.290 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4)
1:44.478 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3)
1:45.948 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2)
1:47.426 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
1:48.421 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2)
1:49.589 default O moonfire enemy3 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:50.725 default O moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:51.862 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:53.310 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
1:54.278 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
1:55.244 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), starlord(3)
1:56.382 default N sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
1:57.519 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
1:58.965 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:59.933 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), starlord(3)
2:01.637 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:02.603 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7)
2:03.841 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:05.371 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:06.392 default G use_items Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), starlord
2:06.392 default I fury_of_elune Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), starlord, ignition_mages_fuse
2:07.543 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), fury_of_elune, starlord, ignition_mages_fuse
2:09.269 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), fury_of_elune, starlord, overwhelming_power(25), ignition_mages_fuse
2:10.325 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(24), ignition_mages_fuse
2:11.089 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), overwhelming_power(23), ignition_mages_fuse(2)
2:11.954 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), ignition_mages_fuse(2)
2:12.709 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(2)
2:13.784 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(2)
2:14.630 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(3)
2:15.384 default M moonfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(3)
2:16.190 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
2:17.120 default O moonfire enemy3 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
2:18.053 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
2:19.243 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(4)
2:20.397 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
2:21.169 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(4)
2:22.512 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(5)
2:23.814 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(2), overwhelming_power(22), ignition_mages_fuse(5)
2:24.766 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), ignition_mages_fuse(5)
2:25.690 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), ignition_mages_fuse(5)
2:26.839 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19)
2:28.227 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), overwhelming_power(17)
2:29.161 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(16)
2:30.263 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
2:31.179 default N sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
2:32.258 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
2:33.637 default O moonfire enemy3 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(12)
2:34.726 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
2:35.653 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
2:36.748 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
2:38.148 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
2:39.090 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers
2:40.036 default O moonfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(5), conch_of_dark_whispers
2:41.150 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:42.826 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
2:43.781 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:45.218 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(6), solar_empowerment, conch_of_dark_whispers
2:46.453 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
2:47.984 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, conch_of_dark_whispers
2:49.187 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
2:50.357 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
2:51.351 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:52.839 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), torrent_of_elements
2:53.834 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements
2:55.001 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:55.842 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:57.102 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements
2:57.943 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements
2:58.931 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:59.772 default M moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:00.761 default O moonfire enemy2 17.5/100: 18% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:01.897 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:03.344 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements
3:04.310 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord(3)
3:06.011 default H celestial_alignment Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment
3:07.090 default E potion Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment
3:07.090 default F berserking Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, battle_potion_of_intellect
3:07.090 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, battle_potion_of_intellect
3:08.069 default I fury_of_elune Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:09.019 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:09.971 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:10.893 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:11.679 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), battle_potion_of_intellect
3:12.754 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), battle_potion_of_intellect
3:13.602 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:14.356 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:15.414 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect
3:16.245 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), battle_potion_of_intellect
3:17.001 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:18.071 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:18.915 default O moonfire enemy2 7.5/100: 8% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:19.758 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:20.547 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:21.737 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:22.534 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:23.731 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:24.532 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:25.682 default L sunfire Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:26.589 default O moonfire enemy3 78.5/100: 79% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:27.636 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power(22), battle_potion_of_intellect
3:28.780 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(21), battle_potion_of_intellect
3:29.894 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(20), battle_potion_of_intellect
3:30.819 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), battle_potion_of_intellect
3:32.209 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(17)
3:33.143 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16)
3:34.546 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
3:35.619 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23)
3:36.393 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
3:37.555 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
3:38.472 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20)
3:39.254 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
3:40.431 default M moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
3:41.356 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
3:42.682 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:43.569 default N sunfire Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
3:44.616 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
3:45.509 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(21)
3:47.087 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, starlord(3), overwhelming_power(19)
3:48.677 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar, overwhelming_power(18)
3:49.837 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17)
3:50.967 default O moonfire enemy2 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
3:52.071 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14)
3:53.487 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13)
3:54.907 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(12)
3:55.858 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(11)
3:56.982 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
3:58.376 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(8)
3:59.315 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(7)
4:00.256 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(6)
4:01.921 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(5)
4:03.036 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3)
4:04.161 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2)
4:05.289 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power
4:06.732 default G use_items Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
4:06.732 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), ignition_mages_fuse
4:07.656 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), starlord(3), ignition_mages_fuse
4:09.286 default I fury_of_elune Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), ignition_mages_fuse
4:10.473 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), fury_of_elune, ignition_mages_fuse
4:11.660 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(2)
4:13.068 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment, starlord, ignition_mages_fuse(2)
4:14.170 default O moonfire enemy3 10.5/100: 11% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(2)
4:15.245 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
4:16.558 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(24), ignition_mages_fuse(3)
4:17.514 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
4:18.306 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
4:19.496 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), ignition_mages_fuse(4)
4:20.402 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
4:21.175 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
4:22.335 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
4:23.112 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), ignition_mages_fuse(5)
4:23.866 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), ignition_mages_fuse(5)
4:25.193 default P lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), ignition_mages_fuse(5)
4:26.527 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), ignition_mages_fuse(5)
4:27.419 default O moonfire enemy2 67.0/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13)
4:28.361 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12)
4:29.166 default P lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(11)
4:30.375 default Q solar_wrath Fluffy_Pillow 92.0/100: 92% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10)
4:31.187 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(9)
4:32.231 default L sunfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8)
4:33.246 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7)
4:34.419 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6)
4:35.874 default O moonfire enemy3 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5)
4:37.020 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(3)
4:38.493 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(2)
4:39.478 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power
4:40.643 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
4:41.610 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:43.057 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
4:44.505 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:45.643 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:46.609 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:48.057 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
4:49.505 default O moonfire enemy2 54.5/100: 55% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
4:50.641 default N sunfire Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
4:51.779 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), solar_empowerment(3)
4:52.831 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(4), solar_empowerment(2)
4:54.069 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
4:55.092 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
4:56.295 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
4:57.290 default O moonfire enemy3 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:58.458 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers
4:59.817 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
5:01.181 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers
5:02.099 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(21), conch_of_dark_whispers
5:03.182 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
5:04.529 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(19), conch_of_dark_whispers
5:05.432 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
5:06.336 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
5:07.246 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(16), conch_of_dark_whispers
5:08.317 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

ripple in space : 59584 dps, 37321 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
59583.8 59583.8 58.4 / 0.098% 6152.1 / 10.3% 7423.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 7.9 Astral Power 0.00% 57.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 59584
Fury of Elune 2589 4.3% 5.3 60.73sec 144694 142817 Direct 388.4 1680 3357 1990 18.4%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 388.40 142.30 0.00 1.0132 0.2963 772783.78 772783.78 0.00 16244.85 142817.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 316.75 81.55% 1680.43 1457 1987 1682.26 1575 1832 532276 532276 0.00
crit 71.65 18.45% 3356.81 2915 3974 3360.23 3098 3762 240507 240507 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 295 (675) 0.5% (1.1%) 8.2 33.06sec 24734 0 Direct 8.2 9132 18271 10808 18.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 88325.30 88325.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.67 81.66% 9131.67 8921 9813 9132.35 8921 9813 60937 60937 0.00
crit 1.50 18.34% 18270.94 17842 19626 14266.72 0 19626 27388 27388 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 380 0.6% 8.2 33.06sec 13926 0 Direct 24.5 3914 7827 4642 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 24.52 0.00 0.00 0.0000 0.0000 113805.84 113805.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.96 81.39% 3913.95 3823 4206 3914.24 3823 4206 78103 78103 0.00
crit 4.56 18.61% 7827.07 7646 8411 7665.32 0 8411 35703 35703 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 9971 16.8% 84.8 3.48sec 35199 26327 Direct 254.4 9893 19745 11733 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.79 254.37 0.00 0.00 1.3370 0.0000 2984456.96 2984456.96 0.00 26326.78 26326.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 206.85 81.32% 9892.71 3345 24211 9900.86 8952 10950 2046359 2046359 0.00
crit 47.52 18.68% 19744.60 6689 48422 19748.49 14487 25869 938098 938098 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9550 16.0% 27.3 10.91sec 104546 100988 Direct 54.6 3526 7054 4180 18.6%  
Periodic 666.4 3324 6643 3943 18.7% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.32 54.64 666.44 666.44 1.0353 1.3330 2856349.67 2856349.67 0.00 3116.03 100988.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.51 81.45% 3525.88 3280 4472 3527.12 3375 3749 156923 156923 0.00
crit 10.14 18.55% 7053.64 6559 8943 7054.11 0 8027 71501 71501 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 542.1 81.34% 3323.87 7 4163 3325.42 3248 3462 1801755 1801755 0.00
crit 124.4 18.66% 6642.88 4 8327 6645.66 6391 6961 826170 826170 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2792 (8607) 4.7% (14.5%) 79.6 3.68sec 32341 37063 Direct 80.2 8772 17531 10401 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.59 80.23 0.00 0.00 0.8726 0.0000 834477.81 834477.81 0.00 37062.60 37062.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.30 81.40% 8771.59 7949 10838 8776.68 8470 9256 572820 572820 0.00
crit 14.93 18.60% 17530.96 15898 21676 17541.45 15898 19757 261658 261658 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 5816 9.8% 74.6 3.91sec 23310 0 Direct 223.9 7770 0 7770 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.63 223.89 0.00 0.00 0.0000 0.0000 1739630.89 1739630.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.89 100.00% 7769.68 5962 16257 7775.53 6872 9204 1739631 1739631 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13343 22.4% 60.0 5.01sec 66526 63828 Direct 59.8 56279 112411 66754 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.98 59.77 0.00 0.00 1.0423 0.0000 3989912.52 3989912.52 0.00 63828.39 63828.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.62 81.34% 56279.01 51347 69612 56307.69 54363 58429 2736105 2736105 0.00
crit 11.15 18.66% 112411.29 102695 139223 112457.75 102695 129494 1253808 1253808 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5893 9.8% 90.1 3.08sec 19448 0 Direct 90.1 16397 32796 19448 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.10 90.10 0.00 0.00 0.0000 0.0000 1752326.39 1752326.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.34 81.40% 16396.95 16021 17623 16397.24 16021 17255 1202576 1202576 0.00
crit 16.76 18.60% 32796.04 32042 35246 32794.94 32042 35017 549750 549750 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 8955 15.0% 18.1 16.74sec 147632 145502 Direct 18.1 4508 9021 5353 18.7%  
Periodic 669.9 3246 6490 3853 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.14 18.14 669.85 669.85 1.0146 1.3323 2677967.50 2677967.50 0.00 2940.14 145502.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.74 81.27% 4507.63 4112 5607 4508.78 4198 4814 66455 66455 0.00
crit 3.40 18.73% 9021.26 8225 11214 8801.70 0 11214 30641 30641 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 544.6 81.30% 3246.13 2 4065 3247.64 3172 3378 1767705 1767705 0.00
crit 125.3 18.70% 6490.09 423 8130 6492.85 6243 6810 813167 813167 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.25sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.90sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8981 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 52.7 45.0sec 5.0sec 93.52% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.42%
  • arcanic_pulsar_2:11.11%
  • arcanic_pulsar_3:11.44%
  • arcanic_pulsar_4:9.52%
  • arcanic_pulsar_5:13.94%
  • arcanic_pulsar_6:11.33%
  • arcanic_pulsar_7:9.58%
  • arcanic_pulsar_8:15.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.2sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.2sec 182.2sec 8.12% 7.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.73% 34.06% 0.0(0.0) 8.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.1sec 45.9sec 23.53% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.7sec 60.7sec 14.09% 0.00% 84.3(84.3) 5.2

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.8 42.4 9.0sec 3.9sec 78.94% 86.10% 1.9(1.9) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.71%
  • lunar_empowerment_2:27.94%
  • lunar_empowerment_3:14.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.5 64.6sec 33.8sec 47.94% 0.00% 3.5(48.4) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.2 49.9 10.9sec 3.9sec 84.81% 92.99% 0.2(0.2) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.55%
  • solar_empowerment_2:38.53%
  • solar_empowerment_3:15.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 44.8 20.4sec 5.0sec 97.14% 92.41% 15.0(15.0) 12.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.25%
  • starlord_2:21.79%
  • starlord_3:59.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.0sec 23.90% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.90%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.0 2399.0 40.0 40.0 1663.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 80.59 644.41 (27.28%) 8.00 0.33 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.39%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.29 210.67 (8.92%) 2.50 0.06 0.03%
sunfire Astral Power 18.14 54.42 (2.30%) 3.00 0.00 0.00%
moonfire Astral Power 27.32 81.97 (3.47%) 3.00 0.00 0.00%
lunar_strike Astral Power 84.79 1017.11 (43.05%) 12.00 0.37 0.04%
natures_balance Astral Power 399.85 199.91 (8.46%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.16 73.91 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.89 8.01
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.00 0.00 71.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data ripple in space Damage Per Second
Count 2990
Mean 59583.76
Minimum 54405.66
Maximum 66405.66
Spread ( max - min ) 12000.01
Range [ ( max - min ) / 2 * 100% ] 10.07%
Standard Deviation 1630.1737
5th Percentile 57023.77
95th Percentile 62284.66
( 95th Percentile - 5th Percentile ) 5260.89
Mean Distribution
Standard Deviation 29.8125
95.00% Confidence Intervall ( 59525.33 - 59642.19 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2876
0.1 Scale Factor Error with Delta=300 22686
0.05 Scale Factor Error with Delta=300 90743
0.01 Scale Factor Error with Delta=300 2268567
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 2990
Mean 37321.18
Minimum 33477.23
Maximum 41992.39
Spread ( max - min ) 8515.17
Range [ ( max - min ) / 2 * 100% ] 11.41%
Standard Deviation 1207.9354
5th Percentile 35393.23
95th Percentile 39370.32
( 95th Percentile - 5th Percentile ) 3977.10
Mean Distribution
Standard Deviation 22.0906
95.00% Confidence Intervall ( 37277.88 - 37364.47 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4025
0.1 Scale Factor Error with Delta=300 12456
0.05 Scale Factor Error with Delta=300 49824
0.01 Scale Factor Error with Delta=300 1245579
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 2990
Mean 59583.76
Minimum 54405.66
Maximum 66405.66
Spread ( max - min ) 12000.01
Range [ ( max - min ) / 2 * 100% ] 10.07%
Damage
Sample Data ripple in space Damage
Count 2990
Mean 17810036.67
Minimum 14121777.32
Maximum 21826317.44
Spread ( max - min ) 7704540.11
Range [ ( max - min ) / 2 * 100% ] 21.63%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.10 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.97 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.03 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.83 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.49 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 85.18 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 79.81 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.53 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQKQPKQPNQPQPOQRKQKQPKMPPPQPQPQKQKQPQPQLKKOPPKOQPPKQPNQQPQKOPKIPQKOPQNQPPJKQKQPKLOPPKOPPQQPKPKPNOQPKQPQOQPPPKKNPGPIKQPKQPKMQOPQQNKPKPQQQKPQOPPKPNOQKPQQPKPQPKOQPQPLPKOKQPPQHEFIKQKNQOQPQJKQPKQPKQPKMPNPPQQQOPKQKQPKLPQPKOQPPPQQOKKPNGPKQPIPKQOPQQPJKKQPKQPQLKOPPQKPOQQPKNPOQPKPQPKPQNOPKPQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.091 default O moonfire enemy2 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.014 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.192 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.999 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.999 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.999 default I fury_of_elune Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.753 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.509 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.264 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.018 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.773 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.529 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.283 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.094 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.849 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.602 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.413 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.167 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.921 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.699 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.454 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.208 default O moonfire enemy3 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.963 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.717 default R sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.472 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.226 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.979 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.733 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.488 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(18), ignition_mages_fuse(5)
0:24.263 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(17), ignition_mages_fuse(5)
0:25.018 default M moonfire Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
0:25.772 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
0:26.643 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25)
0:27.661 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
0:28.684 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23)
0:29.437 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(22)
0:30.650 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(21)
0:31.404 default P lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(20)
0:32.624 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(19)
0:33.442 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(18)
0:34.263 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17)
0:35.016 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16)
0:35.770 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16)
0:36.525 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15)
0:37.443 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(14)
0:38.200 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13)
0:39.125 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12)
0:39.880 default L sunfire Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12)
0:40.634 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, overwhelming_power(11)
0:41.550 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10)
0:42.712 default O moonfire enemy3 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(9)
0:43.842 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(8)
0:45.285 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6), conch_of_dark_whispers
0:46.740 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
0:47.886 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
0:49.007 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), conch_of_dark_whispers
0:49.965 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
0:51.403 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:52.851 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:53.987 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:54.953 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:56.400 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
0:57.439 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:58.324 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:59.214 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:00.552 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(21)
1:01.448 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), overwhelming_power(20)
1:02.602 default O moonfire enemy3 28.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19)
1:03.725 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
1:05.160 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(16)
1:06.294 default I fury_of_elune Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
1:07.399 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14)
1:08.814 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(13)
1:09.762 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2), overwhelming_power(12)
1:10.881 default O moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
1:11.975 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:13.370 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
1:14.306 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers
1:15.413 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers
1:16.356 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(5), conch_of_dark_whispers
1:18.029 default P lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(3), conch_of_dark_whispers
1:19.712 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(2), conch_of_dark_whispers
1:19.712 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), overwhelming_power(2), conch_of_dark_whispers
1:20.943 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power, conch_of_dark_whispers
1:21.828 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, conch_of_dark_whispers
1:22.875 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
1:23.740 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), conch_of_dark_whispers
1:25.035 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
1:26.052 default L sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
1:27.040 default O moonfire enemy3 21.0/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:28.176 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:29.623 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
1:31.071 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
1:32.207 default O moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:33.343 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:34.791 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:36.240 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:37.206 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:38.174 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), starlord(3)
1:39.875 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(3)
1:41.113 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
1:42.645 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment, starlord
1:43.849 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
1:45.337 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
1:46.505 default O moonfire enemy3 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
1:47.673 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
1:48.666 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
1:50.031 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(22)
1:51.110 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21)
1:52.004 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
1:53.352 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:54.256 default O moonfire enemy2 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(18)
1:55.320 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(17)
1:56.227 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(16)
1:57.834 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(15)
1:59.446 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(13)
2:01.070 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(6), overwhelming_power(11)
2:02.259 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10)
2:03.419 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9)
2:04.550 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8)
2:05.994 default G use_items Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7)
2:05.994 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), ignition_mages_fuse
2:07.384 default I fury_of_elune Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse
2:08.410 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse
2:09.439 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse
2:10.194 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.271 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power celestial_alignment, fury_of_elune, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.120 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.876 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.960 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.813 default M moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.639 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.447 default O moonfire enemy2 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.401 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.619 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.404 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.193 default N sunfire Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.091 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.074 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.242 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.161 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.303 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(5)
2:26.069 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
2:26.994 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20)
2:27.919 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(19)
2:29.011 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17)
2:30.371 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(16)
2:31.283 default O moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(15)
2:32.362 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(14)
2:33.978 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(13)
2:35.601 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(11)
2:36.691 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10)
2:38.087 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(8)
2:39.192 default O moonfire enemy2 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(7)
2:40.300 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(6)
2:41.245 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power(5)
2:42.460 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4)
2:43.970 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, overwhelming_power(24)
2:44.908 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(23)
2:45.850 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), starlord, overwhelming_power(22)
2:47.515 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), starlord, overwhelming_power(20)
2:48.634 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(19)
2:50.023 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(17)
2:50.957 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(17)
2:52.604 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(15)
2:53.711 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
2:54.652 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
2:55.454 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12)
2:56.660 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(11)
2:57.469 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, starlord(3), overwhelming_power(10)
2:58.895 default L sunfire Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, starlord(3), overwhelming_power(9)
2:59.853 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power starlord(3), overwhelming_power(8)
3:01.508 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power solar_empowerment, overwhelming_power(6)
3:02.721 default O moonfire enemy3 38.5/100: 39% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(5)
3:03.902 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4)
3:05.087 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(2)
3:06.074 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power
3:07.557 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:09.046 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:10.038 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers
3:11.056 default E potion Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers
3:11.056 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:11.056 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:11.979 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:12.903 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:13.668 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:14.566 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.467 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.232 default O moonfire enemy2 54.5/100: 55% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.132 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.898 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.042 default Q solar_wrath Fluffy_Pillow 92.0/100: 92% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.940 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.940 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), conch_of_dark_whispers, battle_potion_of_intellect
3:20.919 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:21.726 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:22.939 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord, battle_potion_of_intellect
3:23.891 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:24.755 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(2), battle_potion_of_intellect
3:26.050 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25), battle_potion_of_intellect
3:26.978 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:27.749 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:28.905 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:29.814 default M moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:30.726 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect
3:32.066 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:33.127 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:34.486 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:35.847 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:36.758 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(15)
3:37.673 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(14)
3:38.592 default O moonfire enemy3 78.5/100: 79% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13)
3:39.676 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12)
3:41.306 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), solar_empowerment, overwhelming_power(10)
3:42.500 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(9), conch_of_dark_whispers
3:43.361 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8), conch_of_dark_whispers
3:44.376 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers
3:45.219 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(25), conch_of_dark_whispers
3:46.403 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24), conch_of_dark_whispers
3:47.336 default L sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
3:48.247 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
3:49.585 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
3:50.481 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:51.829 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
3:52.889 default O moonfire enemy2 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), conch_of_dark_whispers
3:53.954 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), conch_of_dark_whispers
3:54.861 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
3:56.227 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:57.557 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23)
3:58.893 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(22)
3:59.787 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
4:00.683 default O moonfire enemy3 86.0/100: 86% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
4:01.741 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(3), lunar_empowerment, torrent_of_elements, overwhelming_power(19)
4:02.899 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18)
4:04.027 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16)
4:05.432 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15)
4:06.540 default G use_items Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14)
4:06.540 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14), ignition_mages_fuse
4:07.898 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse
4:08.967 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), ignition_mages_fuse
4:09.855 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse
4:11.190 default I fury_of_elune Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(2)
4:12.202 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(2)
4:13.497 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), ignition_mages_fuse(2)
4:14.517 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), ignition_mages_fuse(2)
4:15.385 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), ignition_mages_fuse(3)
4:16.372 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(3)
4:17.632 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(3), ignition_mages_fuse(3)
4:18.477 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(2), ignition_mages_fuse(3)
4:19.325 default P lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power, ignition_mages_fuse(4)
4:20.769 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(7), starlord(3), ignition_mages_fuse(4)
4:20.769 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(7), ignition_mages_fuse(4)
4:21.820 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(4)
4:22.843 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
4:23.599 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
4:24.659 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse(5)
4:25.493 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:26.248 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)
4:27.280 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
4:28.120 default L sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
4:29.109 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements
4:30.248 default O moonfire enemy3 2.0/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
4:31.384 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
4:32.832 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:34.281 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements
4:35.249 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements
4:36.388 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:37.834 default O moonfire enemy2 14.0/100: 14% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:38.969 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:39.935 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements
4:40.902 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), torrent_of_elements
4:42.757 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), torrent_of_elements
4:43.994 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:45.196 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:46.727 default O moonfire enemy3 26.0/100: 26% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements
4:47.932 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements
4:48.954 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), starlord, torrent_of_elements
4:50.756 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), starlord, torrent_of_elements
4:51.959 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
4:53.448 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements
4:54.443 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), starlord(2)
4:56.193 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), starlord(2)
4:57.362 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
4:58.811 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
4:59.776 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), starlord(3)
5:00.913 default O moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), starlord(3)
5:02.049 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), starlord(3)
5:03.752 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6)
5:04.992 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
5:06.524 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), solar_empowerment, starlord
5:07.546 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), starlord

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

unbound force : 61343 dps, 38423 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
61342.8 61342.8 59.6 / 0.097% 6345.9 / 10.3% 7644.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 7.9 Astral Power 0.00% 57.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 61343
Fury of Elune 2679 4.4% 5.3 60.76sec 149740 147824 Direct 388.5 1684 3332 2058 22.7%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 388.49 142.31 0.00 1.0130 0.2961 799580.20 799580.20 0.00 16818.40 147824.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 300.31 77.30% 1684.12 1457 1987 1686.06 1566 1845 505747 505747 0.00
crit 88.18 22.70% 3332.23 2915 3974 3336.90 3070 3759 293833 293833 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 309 (707) 0.5% (1.2%) 8.3 32.64sec 25533 0 Direct 8.3 9130 18258 11171 22.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.29 8.29 0.00 0.00 0.0000 0.0000 92574.19 92574.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.43 77.63% 9129.86 8921 9813 9124.91 0 9813 58731 58731 0.00
crit 1.85 22.37% 18258.49 17842 19626 15391.56 0 19626 33843 33843 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 398 0.6% 8.3 32.64sec 14361 0 Direct 24.9 3913 7822 4787 22.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.29 24.86 0.00 0.00 0.0000 0.0000 119003.25 119003.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.30 77.65% 3913.18 3823 4206 3912.06 3823 4206 75532 75532 0.00
crit 5.56 22.35% 7822.41 7646 8411 7715.10 0 8411 43471 43471 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 10255 16.7% 84.8 3.48sec 36183 27059 Direct 254.5 9894 19717 12061 22.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.83 254.49 0.00 0.00 1.3372 0.0000 3069347.62 3069347.62 0.00 27058.92 27058.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 198.34 77.94% 9893.63 3345 24211 9900.89 8724 10970 1962400 1962400 0.00
crit 56.14 22.06% 19716.77 6689 48422 19730.05 15334 24542 1106948 1106948 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9829 16.0% 27.3 10.91sec 107679 103988 Direct 54.6 3526 7038 4308 22.3%  
Periodic 666.5 3326 6629 4058 22.2% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.31 54.61 666.54 666.54 1.0355 1.3328 2940253.31 2940253.31 0.00 3207.55 103987.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.46 77.75% 3526.43 3280 4472 3527.68 3365 3730 149730 149730 0.00
crit 12.15 22.25% 7037.69 6559 8943 7041.41 6559 8235 85524 85524 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 518.8 77.83% 3325.91 2 4163 3327.41 3246 3454 1725373 1725373 0.00
crit 147.8 22.17% 6629.39 13 8327 6631.92 6368 6989 979626 979626 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2868 (8845) 4.7% (14.4%) 79.5 3.68sec 33261 38119 Direct 80.2 8778 17492 10696 22.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.55 80.18 0.00 0.00 0.8726 0.0000 857609.30 857609.30 0.00 38118.87 38118.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.53 77.99% 8778.35 7949 10838 8783.10 8438 9185 548941 548941 0.00
crit 17.65 22.01% 17491.88 15898 21676 17498.55 16097 19527 308668 308668 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 5977 9.8% 74.5 3.90sec 24003 0 Direct 223.5 8001 0 8001 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.50 223.51 0.00 0.00 0.0000 0.0000 1788298.04 1788298.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.51 100.00% 8000.64 5962 16257 8003.26 6890 9375 1788298 1788298 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6557.86
  • base_dd_max:6557.86
  • base_dd_mult:1.00
 
Starsurge 13766 22.5% 60.0 5.01sec 68647 65870 Direct 59.8 56306 112194 68874 22.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.97 59.77 0.00 0.00 1.0422 0.0000 4116910.55 4116910.55 0.00 65869.51 65869.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.33 77.51% 56305.73 51347 69612 56334.01 54303 59695 2608644 2608644 0.00
crit 13.44 22.49% 112194.21 102695 139223 112238.29 102695 127693 1508266 1508266 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6042 9.8% 90.1 3.08sec 19944 0 Direct 90.1 16390 32798 19944 21.7%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.09 90.09 0.00 0.00 0.0000 0.0000 1796820.91 1796820.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.58 78.34% 16389.72 16021 17623 16389.73 16021 17235 1156792 1156792 0.00
crit 19.51 21.66% 32798.20 32042 35246 32794.59 32042 34890 640029 640029 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 9219 15.0% 18.1 16.75sec 151978 149792 Direct 18.1 4508 9011 5509 22.2%  
Periodic 669.9 3248 6475 3967 22.3% 297.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.14 18.14 669.88 669.88 1.0146 1.3321 2757363.54 2757363.54 0.00 3027.47 149791.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.11 77.78% 4508.23 4112 5607 4509.14 4216 4896 63616 63616 0.00
crit 4.03 22.22% 9010.84 8225 11214 8929.07 0 11214 36334 36334 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 520.6 77.72% 3247.96 4 4065 3249.39 3169 3383 1690943 1690943 0.00
crit 149.3 22.28% 6475.06 28 8130 6477.61 6231 6802 966471 966471 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.32sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.12sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8970 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 52.7 45.0sec 5.0sec 93.52% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.42%
  • arcanic_pulsar_2:11.12%
  • arcanic_pulsar_3:11.45%
  • arcanic_pulsar_4:9.51%
  • arcanic_pulsar_5:13.93%
  • arcanic_pulsar_6:11.39%
  • arcanic_pulsar_7:9.54%
  • arcanic_pulsar_8:15.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.3sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.3sec 182.3sec 8.12% 7.82% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.72% 34.12% 0.0(0.0) 8.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.5sec 46.2sec 23.31% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.08% 0.00% 84.3(84.3) 5.2

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.7 42.5 9.0sec 3.9sec 78.92% 86.04% 1.9(1.9) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.56%
  • lunar_empowerment_2:27.96%
  • lunar_empowerment_3:14.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.4 64.2sec 33.9sec 48.18% 0.00% 3.4(47.6) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.39%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.47%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.60%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.69%
  • overwhelming_power_9:1.74%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 67.5sec 67.5sec 5.24% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 83.5 67.4sec 3.4sec 91.46% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.50%
  • reckless_force_counter_2:5.17%
  • reckless_force_counter_3:5.16%
  • reckless_force_counter_4:5.12%
  • reckless_force_counter_5:5.06%
  • reckless_force_counter_6:4.98%
  • reckless_force_counter_7:4.94%
  • reckless_force_counter_8:4.93%
  • reckless_force_counter_9:4.84%
  • reckless_force_counter_10:4.84%
  • reckless_force_counter_11:4.79%
  • reckless_force_counter_12:4.72%
  • reckless_force_counter_13:4.68%
  • reckless_force_counter_14:4.58%
  • reckless_force_counter_15:4.58%
  • reckless_force_counter_16:4.47%
  • reckless_force_counter_17:4.45%
  • reckless_force_counter_18:4.40%
  • reckless_force_counter_19:4.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 27.2 49.8 10.9sec 3.9sec 84.73% 92.90% 0.2(0.2) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.59%
  • solar_empowerment_2:38.46%
  • solar_empowerment_3:15.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 44.8 20.4sec 5.0sec 97.13% 92.42% 15.0(15.0) 12.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.24%
  • starlord_2:21.75%
  • starlord_3:59.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.6sec 45.3sec 23.89% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.89%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 60.0 2398.9 40.0 40.0 1716.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 80.55 644.00 (27.26%) 8.00 0.37 0.06%
celestial_alignment Astral Power 2.00 80.00 (3.39%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.24 210.52 (8.91%) 2.50 0.08 0.04%
sunfire Astral Power 18.14 54.43 (2.30%) 3.00 0.00 0.00%
moonfire Astral Power 27.31 81.92 (3.47%) 3.00 0.00 0.00%
lunar_strike Astral Power 84.83 1017.62 (43.08%) 12.00 0.38 0.04%
natures_balance Astral Power 399.85 199.91 (8.46%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.16 73.91 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.89 8.01
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.67 0.00 69.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data unbound force Damage Per Second
Count 2990
Mean 61342.79
Minimum 56194.74
Maximum 66801.34
Spread ( max - min ) 10606.59
Range [ ( max - min ) / 2 * 100% ] 8.65%
Standard Deviation 1663.3556
5th Percentile 58792.41
95th Percentile 64258.57
( 95th Percentile - 5th Percentile ) 5466.17
Mean Distribution
Standard Deviation 30.4193
95.00% Confidence Intervall ( 61283.17 - 61402.41 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2825
0.1 Scale Factor Error with Delta=300 23619
0.05 Scale Factor Error with Delta=300 94475
0.01 Scale Factor Error with Delta=300 2361859
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 2990
Mean 38422.70
Minimum 34702.73
Maximum 42484.45
Spread ( max - min ) 7781.72
Range [ ( max - min ) / 2 * 100% ] 10.13%
Standard Deviation 1225.6561
5th Percentile 36531.82
95th Percentile 40578.34
( 95th Percentile - 5th Percentile ) 4046.53
Mean Distribution
Standard Deviation 22.4147
95.00% Confidence Intervall ( 38378.77 - 38466.63 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3909
0.1 Scale Factor Error with Delta=300 12824
0.05 Scale Factor Error with Delta=300 51296
0.01 Scale Factor Error with Delta=300 1282393
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 2990
Mean 61342.79
Minimum 56194.74
Maximum 66801.34
Spread ( max - min ) 10606.59
Range [ ( max - min ) / 2 * 100% ] 8.65%
Damage
Sample Data unbound force Damage
Count 2990
Mean 18337760.90
Minimum 14534624.17
Maximum 22102928.44
Spread ( max - min ) 7568304.27
Range [ ( max - min ) / 2 * 100% ] 20.64%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.11 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.97 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.03 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.84 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.57 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.47 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 85.21 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 79.76 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.54 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQPKQPKQNQPQPOQRKQPKQPKOPPPQPPKQKQPQPQLQKKOPPKQOPQKPQPNQPQKPKOIPQKOPNQPQPJKQKQPKLQOPKQPOPQPQPKKPNPQKQOPQKPOQQPKNPQKGIQPKQMOKPPQQPNKPKQPPKQPQPKOOPNQQKPQPKPQPPKQNQPQPOKKOPPQHEFIKQKNQPQOQKQPQKQPKQPKOPNPPQPQQJKOKQKQPPPKNOPQQPPPKKOPPGKNQIPPKOQPQQPKKOQKQPQLPKPPQKPOPQKNPQOPKPQPKPQQQPNKOPQKP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.240 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.166 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:03.091 default O moonfire enemy3 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:04.016 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter, battle_potion_of_intellect
0:05.194 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(2), battle_potion_of_intellect
0:05.999 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect
0:05.999 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect
0:05.999 default I fury_of_elune Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.754 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.509 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.264 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.018 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.772 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.552 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.307 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.061 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.818 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.572 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.327 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.080 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.835 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.591 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.347 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.101 default O moonfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.854 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.607 default R sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.361 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(12), reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.115 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11), reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.869 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(11), reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.712 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(10), reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.465 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), reckless_force_counter(9), ignition_mages_fuse(5)
0:24.220 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(8), reckless_force_counter(9), ignition_mages_fuse(5)
0:25.017 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), reckless_force_counter(9), ignition_mages_fuse(5)
0:25.771 default O moonfire enemy2 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), reckless_force_counter(10), ignition_mages_fuse(5)
0:26.526 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), reckless_force_counter(10)
0:27.544 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(10)
0:28.566 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(11)
0:29.591 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), reckless_force_counter(12)
0:30.346 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(21), reckless_force_counter(12)
0:31.560 default P lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(20), reckless_force_counter(12)
0:32.780 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(19), reckless_force_counter(12)
0:33.598 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(12)
0:34.354 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(12), conch_of_dark_whispers
0:35.109 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(12), conch_of_dark_whispers
0:35.864 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(13), conch_of_dark_whispers
0:36.753 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(13), conch_of_dark_whispers
0:37.509 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(13), conch_of_dark_whispers
0:38.405 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(13), conch_of_dark_whispers
0:39.160 default L sunfire Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(20), reckless_force_counter(13), conch_of_dark_whispers
0:39.915 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(25), reckless_force_counter(13), conch_of_dark_whispers
0:40.715 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar, overwhelming_power(24), reckless_force_counter(13), conch_of_dark_whispers
0:41.590 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), reckless_force_counter(13), conch_of_dark_whispers
0:42.699 default O moonfire enemy3 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), reckless_force_counter(13), conch_of_dark_whispers
0:43.781 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), reckless_force_counter(13), conch_of_dark_whispers
0:45.162 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), reckless_force_counter(13), conch_of_dark_whispers
0:46.551 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(18), reckless_force_counter(13), conch_of_dark_whispers
0:47.648 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), reckless_force_counter(13), conch_of_dark_whispers
0:48.556 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(13), conch_of_dark_whispers
0:49.628 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(13)
0:50.999 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(14)
0:51.917 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(15)
0:53.003 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(15)
0:54.394 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(15)
0:55.325 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), reckless_force_counter(15)
0:56.726 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(17)
0:57.827 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(17)
0:58.769 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), reckless_force_counter(17)
1:00.183 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), reckless_force_counter(17)
1:01.135 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), torrent_of_elements, overwhelming_power(3), reckless_force_counter(17)
1:02.361 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), reckless_force_counter(18)
1:03.883 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements, overwhelming_power, reckless_force_counter(18)
1:05.081 default O moonfire enemy2 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18)
1:06.250 default I fury_of_elune Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers
1:07.419 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(19), conch_of_dark_whispers
1:08.907 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power reckless_force, arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:09.901 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power reckless_force, arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
1:11.068 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power reckless_force, arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:12.204 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power reckless_force, arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:13.650 default N sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:14.786 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:15.751 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter, conch_of_dark_whispers
1:17.198 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(2), conch_of_dark_whispers
1:18.164 default P lunar_strike Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(2), conch_of_dark_whispers
1:19.493 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(2), conch_of_dark_whispers
1:19.493 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), solar_empowerment(2), overwhelming_power(23), reckless_force_counter(2), conch_of_dark_whispers
1:20.634 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(22), reckless_force_counter(2)
1:21.456 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(21), reckless_force_counter(3)
1:22.426 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(20), reckless_force_counter(3)
1:23.230 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), reckless_force_counter(3)
1:24.439 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), reckless_force_counter(3)
1:25.391 default L sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25), reckless_force_counter(3)
1:26.295 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), reckless_force_counter(3)
1:27.182 default O moonfire enemy3 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(3)
1:28.228 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(3)
1:29.566 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(3)
1:30.619 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), reckless_force_counter(3)
1:31.519 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(3)
1:32.870 default O moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(4)
1:33.933 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(4)
1:35.293 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(4)
1:36.209 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), reckless_force_counter(4)
1:37.584 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(4)
1:38.506 default P lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(12), reckless_force_counter(4)
1:40.134 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(3), overwhelming_power(10), reckless_force_counter(6)
1:41.328 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), reckless_force_counter(7)
1:42.491 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8), reckless_force_counter(8)
1:43.936 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), reckless_force_counter(9)
1:45.075 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), reckless_force_counter(9)
1:46.535 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(4), reckless_force_counter(9)
1:47.512 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(3), reckless_force_counter(10)
1:48.669 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(2), reckless_force_counter(10)
1:49.627 default O moonfire enemy2 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, reckless_force_counter(10)
1:50.759 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(10)
1:52.206 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), reckless_force_counter(10)
1:53.173 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), reckless_force_counter(11)
1:54.309 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(11)
1:55.756 default O moonfire enemy3 20.0/100: 20% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(11)
1:56.893 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(11)
1:57.858 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(12)
1:58.823 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(12)
2:00.527 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), solar_empowerment, reckless_force_counter(12)
2:01.767 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(12)
2:02.969 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(12)
2:04.500 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, reckless_force_counter(12)
2:05.522 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), solar_empowerment, starlord, reckless_force_counter(12)
2:06.724 default G use_items Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(13)
2:06.724 default I fury_of_elune Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(13), ignition_mages_fuse
2:07.699 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(14), ignition_mages_fuse
2:08.525 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(14), ignition_mages_fuse
2:09.764 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, fury_of_elune, solar_empowerment, starlord(2), reckless_force_counter(14), ignition_mages_fuse
2:10.737 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(15), ignition_mages_fuse(2)
2:11.509 default M moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(16), ignition_mages_fuse(2)
2:12.418 default O moonfire enemy2 35.5/100: 36% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(16), ignition_mages_fuse(2)
2:13.461 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(16), ignition_mages_fuse(2)
2:14.506 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(16), ignition_mages_fuse(2)
2:15.836 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(16), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.116 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), reckless_force_counter(16), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.970 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.823 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), starlord(3), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.272 default N sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), starlord(3), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.240 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(2), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.293 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(4)
2:23.594 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.578 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.391 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.611 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(5)
2:27.829 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers
2:28.997 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(19), conch_of_dark_whispers
2:29.964 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(19), conch_of_dark_whispers
2:31.411 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power reckless_force, arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
2:32.378 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power reckless_force, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
2:33.826 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power reckless_force, arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
2:34.963 default O moonfire enemy2 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:36.100 default O moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:37.237 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter, conch_of_dark_whispers
2:38.685 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), reckless_force_counter, conch_of_dark_whispers
2:39.821 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), reckless_force_counter, conch_of_dark_whispers
2:40.788 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), reckless_force_counter, conch_of_dark_whispers
2:41.754 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), reckless_force_counter, conch_of_dark_whispers
2:42.993 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, conch_of_dark_whispers
2:44.527 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord, reckless_force_counter(2), conch_of_dark_whispers
2:45.549 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, starlord, reckless_force_counter(2), conch_of_dark_whispers
2:47.083 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), starlord, reckless_force_counter(3), conch_of_dark_whispers
2:48.286 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(3), conch_of_dark_whispers
2:49.775 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), reckless_force_counter(3), conch_of_dark_whispers
2:50.768 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), starlord(2), reckless_force_counter(3)
2:52.517 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), starlord(2), reckless_force_counter(3)
2:54.268 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(23), reckless_force_counter(4)
2:55.345 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(4)
2:56.121 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(5)
2:57.037 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(6)
2:57.958 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(6)
2:59.131 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(7)
2:59.917 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, starlord(3), overwhelming_power(18), reckless_force_counter(7)
3:01.303 default O moonfire enemy2 78.5/100: 79% astral_power starlord(3), overwhelming_power(16), reckless_force_counter(8)
3:02.375 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power overwhelming_power(15), reckless_force_counter(9)
3:03.546 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), reckless_force_counter(9)
3:04.690 default O moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), reckless_force_counter(9)
3:05.803 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), reckless_force_counter(9)
3:07.230 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), reckless_force_counter(9)
3:08.664 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(9), reckless_force_counter(9)
3:09.626 default H celestial_alignment Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8), reckless_force_counter(9)
3:10.617 default E potion Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), reckless_force_counter(10)
3:10.617 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), reckless_force_counter(10), battle_potion_of_intellect
3:10.617 default I fury_of_elune Fluffy_Pillow 83.0/100: 83% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), reckless_force_counter(10), battle_potion_of_intellect
3:11.518 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6), reckless_force_counter(11), battle_potion_of_intellect
3:12.421 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5), reckless_force_counter(11), battle_potion_of_intellect
3:13.174 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), reckless_force_counter(11), conch_of_dark_whispers, battle_potion_of_intellect
3:14.062 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3), reckless_force_counter(11), conch_of_dark_whispers, battle_potion_of_intellect
3:14.951 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3), reckless_force_counter(11), conch_of_dark_whispers, battle_potion_of_intellect
3:15.708 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), reckless_force_counter(11), conch_of_dark_whispers, battle_potion_of_intellect
3:16.845 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, reckless_force_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:17.607 default O moonfire enemy2 79.0/100: 79% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:18.507 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:19.271 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:20.171 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:20.935 default P lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), reckless_force_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:21.983 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:22.740 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(23), reckless_force_counter(13), conch_of_dark_whispers, battle_potion_of_intellect
3:23.732 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(25), reckless_force_counter(13), conch_of_dark_whispers, battle_potion_of_intellect
3:24.545 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(24), reckless_force_counter(13), conch_of_dark_whispers, battle_potion_of_intellect
3:25.767 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(23), reckless_force_counter(13), conch_of_dark_whispers, battle_potion_of_intellect
3:26.730 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(22), reckless_force_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:27.528 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(21), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:28.730 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(20), reckless_force_counter(16), battle_potion_of_intellect
3:29.675 default O moonfire enemy3 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), reckless_force_counter(16), battle_potion_of_intellect
3:30.738 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(17), battle_potion_of_intellect
3:32.094 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(18), battle_potion_of_intellect
3:33.167 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(18), battle_potion_of_intellect
3:34.537 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:35.913 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power reckless_force, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(25)
3:36.797 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
3:38.125 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power reckless_force, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(22)
3:39.018 default Q solar_wrath Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21)
3:40.072 default J cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), reckless_force_counter, conch_of_dark_whispers
3:40.072 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), overwhelming_power(20), reckless_force_counter, conch_of_dark_whispers
3:41.223 default O moonfire enemy2 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), reckless_force_counter, conch_of_dark_whispers
3:42.199 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), reckless_force_counter, conch_of_dark_whispers
3:43.180 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter, conch_of_dark_whispers
3:43.993 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), reckless_force_counter, conch_of_dark_whispers
3:44.950 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter, conch_of_dark_whispers
3:45.743 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), reckless_force_counter(2), conch_of_dark_whispers
3:46.934 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(3), conch_of_dark_whispers
3:48.310 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), reckless_force_counter(4), conch_of_dark_whispers
3:49.696 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(5), conch_of_dark_whispers
3:50.788 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), reckless_force_counter(5), conch_of_dark_whispers
3:51.883 default O moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), reckless_force_counter(6), conch_of_dark_whispers
3:52.981 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), reckless_force_counter(6), conch_of_dark_whispers
3:54.387 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), reckless_force_counter(6), conch_of_dark_whispers
3:55.330 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), reckless_force_counter(7), conch_of_dark_whispers
3:56.280 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(4), reckless_force_counter(7), conch_of_dark_whispers
3:57.959 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(3), reckless_force_counter(7), conch_of_dark_whispers
3:59.644 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power, reckless_force_counter(9), conch_of_dark_whispers
4:01.340 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(3), torrent_of_elements, reckless_force_counter(9), conch_of_dark_whispers
4:02.578 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(10), conch_of_dark_whispers
4:03.780 default O moonfire enemy2 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(10), conch_of_dark_whispers
4:04.949 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(11), conch_of_dark_whispers
4:06.438 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(11), conch_of_dark_whispers
4:07.927 default G use_items Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), reckless_force_counter(11), conch_of_dark_whispers
4:07.927 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), reckless_force_counter(11), conch_of_dark_whispers, ignition_mages_fuse
4:09.045 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(11), conch_of_dark_whispers, ignition_mages_fuse
4:10.133 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse
4:11.057 default I fury_of_elune Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse
4:12.144 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.474 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.806 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.852 default O moonfire enemy3 24.0/100: 24% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(2)
4:16.895 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.748 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.028 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.884 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(3)
4:20.738 default P lunar_strike Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(14), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.187 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(7), reckless_force_counter(14), conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.239 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(14), conch_of_dark_whispers, ignition_mages_fuse(4)
4:24.261 default O moonfire enemy2 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(14), ignition_mages_fuse(5)
4:25.092 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(14), ignition_mages_fuse(5)
4:25.847 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(14), ignition_mages_fuse(5)
4:26.681 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(14), ignition_mages_fuse(5)
4:27.435 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(15), ignition_mages_fuse(5)
4:28.468 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(16)
4:29.308 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(16)
4:30.297 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), reckless_force_counter(16)
4:31.745 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), reckless_force_counter(16)
4:32.881 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(16)
4:34.329 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(17)
4:35.779 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), reckless_force_counter(17)
4:36.746 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(25), reckless_force_counter(17)
4:37.785 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(17)
4:39.113 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(17)
4:40.165 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(18)
4:41.506 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(18)
4:42.405 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), overwhelming_power(19), reckless_force_counter(18)
4:43.563 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), reckless_force_counter(18)
4:44.690 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), reckless_force_counter(19)
4:46.130 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(15), reckless_force_counter(19)
4:47.099 default O moonfire enemy3 29.0/100: 29% astral_power arcanic_pulsar(4), starlord, overwhelming_power(14), reckless_force_counter(19)
4:48.241 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), starlord, overwhelming_power(13), reckless_force_counter(19)
4:49.957 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), starlord, overwhelming_power(12), reckless_force_counter(19)
4:51.106 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(10), reckless_force_counter(19)
4:52.540 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power reckless_force, arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(9)
4:53.503 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power reckless_force, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(8)
4:54.947 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reckless_force, arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(7)
4:56.085 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power reckless_force, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)
4:57.506 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(4)
4:58.457 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(3)
4:59.412 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(2)
5:00.370 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power
5:02.066 default N sunfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter
5:03.203 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), reckless_force_counter
5:04.440 default O moonfire enemy2 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter
5:05.643 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), reckless_force_counter
5:07.043 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(23), reckless_force_counter(2)
5:07.984 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), starlord, overwhelming_power(25), reckless_force_counter(2)
5:09.085 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(23), reckless_force_counter(2)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

visions : 60789 dps, 38264 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
60788.5 60788.5 50.4 / 0.083% 5447.3 / 9.0% 7550.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 60789
Fury of Elune 2494 4.1% 5.3 60.89sec 140115 136309 Direct 382.6 1649 3290 1953 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 382.58 135.88 0.00 1.0281 0.3094 747107.69 747107.69 0.00 15721.63 136308.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 311.74 81.48% 1648.83 1472 2007 1648.53 1587 1760 514028 514028 0.00
crit 70.84 18.52% 3289.94 2944 4015 3288.80 3070 3652 233079 233079 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 303 (692) 0.5% (1.1%) 8.3 33.00sec 25025 0 Direct 8.3 9228 18443 10957 18.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 90651.62 90651.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.22% 9227.61 9012 9913 9228.76 9012 9913 62000 62000 0.00
crit 1.55 18.78% 18442.76 18024 19826 14724.27 0 19826 28652 28652 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 389 0.6% 8.3 33.00sec 14067 0 Direct 24.8 3954 7913 4689 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 24.82 0.00 0.00 0.0000 0.0000 116362.59 116362.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.21 81.43% 3953.66 3862 4248 3954.19 3862 4206 79903 79903 0.00
crit 4.61 18.57% 7912.98 7725 8497 7777.20 0 8497 36459 36459 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 10040 16.5% 83.3 3.55sec 36081 27099 Direct 249.9 10138 20241 12027 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.30 249.90 0.00 0.00 1.3314 0.0000 3005544.15 3005544.15 0.00 27099.44 27099.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 203.17 81.30% 10137.60 3379 24458 10139.58 9061 11156 2059659 2059659 0.00
crit 46.73 18.70% 20241.36 6757 48917 20236.54 14454 25638 945885 945885 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 9695 15.9% 27.3 10.90sec 106169 102765 Direct 54.7 3583 7165 4248 18.6%  
Periodic 666.9 3376 6747 4004 18.6% 296.7%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.34 54.68 666.86 666.86 1.0331 1.3324 2902607.54 2902607.54 0.00 3166.19 102765.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.53 81.45% 3583.40 3313 4517 3583.63 3402 3807 159584 159584 0.00
crit 10.15 18.55% 7165.49 6626 9035 7165.17 6626 8470 72698 72698 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 542.6 81.37% 3376.37 2 4206 3376.70 3301 3505 1832193 1832193 0.00
crit 124.2 18.63% 6746.95 12 8412 6747.03 6478 7143 838133 838133 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2891 (8797) 4.8% (14.5%) 81.1 3.61sec 32480 37119 Direct 81.7 8924 17851 10595 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.11 81.70 0.00 0.00 0.8750 0.0000 865661.07 865661.07 0.00 37119.17 37119.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.41 81.28% 8924.13 8030 10949 8926.16 8622 9399 592697 592697 0.00
crit 15.29 18.72% 17851.15 16060 21898 17853.39 16060 19768 272964 272964 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 5906 9.7% 74.7 3.90sec 23693 0 Direct 224.0 7898 0 7898 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.66 223.97 0.00 0.00 0.0000 0.0000 1768834.61 1768834.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.97 100.00% 7897.55 6023 16423 7898.54 6985 9091 1768835 1768835 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:15237.14
  • base_dd_max:15237.14
  • base_dd_mult:1.00
 
Starsurge 13555 22.3% 60.3 4.99sec 67342 64407 Direct 60.0 56976 113861 67609 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.28 60.05 0.00 0.00 1.0456 0.0000 4059679.66 4059679.66 0.00 64406.65 64406.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.83 81.31% 56975.56 51872 70323 56977.79 54738 59548 2781906 2781906 0.00
crit 11.22 18.69% 113860.86 103744 140646 113821.03 103744 128807 1277774 1277774 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6428 10.6% 98.2 2.87sec 19643 0 Direct 98.2 16560 33123 19643 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.25 98.25 0.00 0.00 0.0000 0.0000 1929893.07 1929893.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.96 81.39% 16560.26 16184 17803 16559.58 16184 17380 1324189 1324189 0.00
crit 18.29 18.61% 33123.29 32369 35606 33121.29 32369 35426 605704 605704 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 9087 14.9% 18.1 16.78sec 150392 148113 Direct 18.1 4567 9126 5430 18.9%  
Periodic 670.2 3297 6590 3912 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.09 18.09 670.23 670.23 1.0154 1.3317 2720538.58 2720538.58 0.00 2986.69 148112.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.66 81.06% 4566.72 4154 5664 4566.43 4260 4945 66963 66963 0.00
crit 3.43 18.94% 9125.61 8309 11329 8847.91 0 11329 31271 31271 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 545.0 81.32% 3297.36 22 4107 3297.64 3219 3427 1797160 1797160 0.00
crit 125.2 18.68% 6589.66 140 8213 6589.85 6347 7004 825144 825144 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 213.93sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.5 147.56sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.50 0.00 0.00 0.00 0.9101 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:144.965
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.0 45.0sec 5.0sec 93.32% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.47%
  • arcanic_pulsar_2:11.07%
  • arcanic_pulsar_3:12.51%
  • arcanic_pulsar_4:10.93%
  • arcanic_pulsar_5:13.09%
  • arcanic_pulsar_6:10.99%
  • arcanic_pulsar_7:9.12%
  • arcanic_pulsar_8:14.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 153.6sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 214.1sec 214.1sec 8.12% 8.08% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 7.6 0.0 41.0sec 41.0sec 28.11% 36.08% 0.0(0.0) 7.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.0sec 46.0sec 23.50% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.9sec 60.9sec 14.05% 0.00% 84.1(84.1) 5.2

Buff details

  • buff initial source:visions
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.5 0.0 147.7sec 147.7sec 15.95% 0.00% 2.3(2.3) 2.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.28%
  • ignition_mages_fuse_2:3.24%
  • ignition_mages_fuse_3:3.19%
  • ignition_mages_fuse_4:3.14%
  • ignition_mages_fuse_5:3.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.0 43.7 9.1sec 3.9sec 80.89% 87.95% 2.0(2.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:37.48%
  • lunar_empowerment_2:29.97%
  • lunar_empowerment_3:13.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.4 64.7sec 34.3sec 47.58% 0.00% 3.4(47.4) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.4 49.6 10.8sec 3.9sec 84.91% 91.39% 0.2(0.2) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.66%
  • solar_empowerment_2:38.29%
  • solar_empowerment_3:16.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.1 20.4sec 5.0sec 97.29% 92.54% 15.2(15.2) 12.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.56%
  • starlord_2:22.85%
  • starlord_3:57.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.6sec 45.8sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 60.3 2411.3 40.0 40.0 1683.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 82.11 656.59 (27.63%) 8.00 0.30 0.05%
celestial_alignment Astral Power 2.50 99.87 (4.20%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.05 210.11 (8.84%) 2.50 0.01 0.01%
sunfire Astral Power 18.09 54.27 (2.28%) 3.00 0.00 0.00%
moonfire Astral Power 27.34 82.02 (3.45%) 3.00 0.00 0.00%
lunar_strike Astral Power 83.30 999.06 (42.05%) 11.99 0.53 0.05%
natures_balance Astral Power 399.85 199.92 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.18 74.18 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.93 8.05
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.92 0.00 90.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data visions Damage Per Second
Count 2990
Mean 60788.52
Minimum 56510.46
Maximum 66524.02
Spread ( max - min ) 10013.56
Range [ ( max - min ) / 2 * 100% ] 8.24%
Standard Deviation 1406.3378
5th Percentile 58499.96
95th Percentile 63096.79
( 95th Percentile - 5th Percentile ) 4596.83
Mean Distribution
Standard Deviation 25.7190
95.00% Confidence Intervall ( 60738.11 - 60838.93 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2057
0.1 Scale Factor Error with Delta=300 16884
0.05 Scale Factor Error with Delta=300 67535
0.01 Scale Factor Error with Delta=300 1688352
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 2990
Mean 38263.77
Minimum 35075.39
Maximum 42460.98
Spread ( max - min ) 7385.59
Range [ ( max - min ) / 2 * 100% ] 9.65%
Standard Deviation 1051.5356
5th Percentile 36541.52
95th Percentile 40026.39
( 95th Percentile - 5th Percentile ) 3484.87
Mean Distribution
Standard Deviation 19.2304
95.00% Confidence Intervall ( 38226.08 - 38301.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 2902
0.1 Scale Factor Error with Delta=300 9440
0.05 Scale Factor Error with Delta=300 37757
0.01 Scale Factor Error with Delta=300 943913
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 2990
Mean 60788.52
Minimum 56510.46
Maximum 66524.02
Spread ( max - min ) 10013.56
Range [ ( max - min ) / 2 * 100% ] 8.24%
Damage
Sample Data visions Damage
Count 2990
Mean 18206880.58
Minimum 14003623.48
Maximum 22599611.73
Spread ( max - min ) 8595988.25
Range [ ( max - min ) / 2 * 100% ] 23.61%
DTPS
Sample Data visions Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.49 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.50 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.33 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.18 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.28 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.73 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.79 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.55 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 83.64 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 81.34 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.60 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQPKQPKQNQPQPOQOKQKQPKLPPPQPQPQKQKQPQPQMKKNOPPKQPPKQPQQPPKNOIKOPPKQPPQQQNJKQKQKQPMPKOPPQKPNPQKPQQPKOPQPKNOPQQPKPQPKIQKQPLKOPOPPQKQKQPQPHEGNOKQKQPQPOQPJKQKQPKQPNKQPQPKQMOPPPQKQPKINQPQKQPKOOQPQPNQKQPKQPKFQPKQPQKONOPQPKQPPQKQPPKNQOPQOPIKQKQPKQPNPQQPOQJKOKQKQLPPKQPPPQQPPKKONOPPHGKQKQPQPQKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.166 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.093 default O moonfire enemy3 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.018 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.197 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.003 default F berserking Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.003 default G use_items Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.003 default I fury_of_elune Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.758 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:07.513 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.268 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.022 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.776 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:10.622 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.376 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.129 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.939 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.692 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.448 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.202 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.958 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.736 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.492 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.273 default O moonfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.030 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.784 default O moonfire enemy3 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.537 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.292 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.049 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.804 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.559 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.375 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:25.131 default L sunfire Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(5)
0:25.885 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(5)
0:26.799 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3)
0:27.913 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3)
0:29.028 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
0:29.783 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:31.093 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
0:31.845 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
0:32.960 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:33.837 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:34.714 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
0:35.470 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:36.230 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
0:36.984 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:37.953 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:38.714 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:39.684 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), conch_of_dark_whispers
0:40.446 default M moonfire Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), conch_of_dark_whispers
0:41.207 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar, conch_of_dark_whispers
0:42.446 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
0:43.647 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:44.816 default O moonfire enemy3 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:45.985 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:47.474 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:48.963 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2)
0:50.133 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
0:51.099 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:52.546 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:53.992 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
0:55.129 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
0:56.094 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
0:57.422 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:58.312 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(22)
0:59.205 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(21)
1:00.784 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(20)
1:02.367 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(5), overwhelming_power(18)
1:03.527 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17)
1:04.657 default O moonfire enemy3 34.0/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(16)
1:05.792 default I fury_of_elune Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15)
1:07.145 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
1:08.293 default O moonfire enemy2 9.5/100: 10% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(12)
1:09.412 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11)
1:10.841 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10)
1:12.275 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8)
1:13.411 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7)
1:14.353 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
1:15.772 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
1:17.192 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3)
1:18.151 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
1:19.111 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
1:19.995 default N sunfire Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(25)
1:21.034 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(23)
1:21.034 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(23)
1:22.175 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25)
1:22.989 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(25)
1:23.946 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24)
1:24.740 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(23)
1:25.677 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22)
1:26.453 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21)
1:27.620 default M moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25)
1:28.524 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(24)
1:29.852 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(25)
1:30.892 default O moonfire enemy3 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24)
1:31.935 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23)
1:33.268 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
1:34.609 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
1:35.508 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
1:36.569 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
1:37.926 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
1:38.992 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
1:40.357 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
1:41.276 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, torrent_of_elements, overwhelming_power(13)
1:42.457 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(12)
1:43.923 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(11)
1:44.905 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10)
1:45.892 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(9)
1:47.633 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), starlord, overwhelming_power(7)
1:48.804 default O moonfire enemy2 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(6)
1:49.946 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(5)
1:51.407 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(3)
1:52.392 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(2)
1:54.131 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2)
1:55.299 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:56.437 default O moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:57.573 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:59.019 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:59.988 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:00.954 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), starlord(3)
2:02.655 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7)
2:03.893 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:05.426 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:06.449 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, starlord
2:07.981 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), starlord
2:09.183 default I fury_of_elune Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
2:10.199 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
2:11.064 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
2:12.079 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
2:12.920 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
2:14.179 default L sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
2:15.167 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
2:16.303 default O moonfire enemy3 14.5/100: 14% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
2:17.439 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
2:18.887 default O moonfire enemy2 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers
2:19.925 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
2:21.255 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
2:22.592 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
2:23.487 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(2), solar_empowerment(2), overwhelming_power(20), conch_of_dark_whispers
2:24.638 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(19)
2:25.590 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18)
2:26.718 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(17)
2:27.654 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
2:29.058 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(14)
2:30.002 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13)
2:31.422 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(12)
2:32.396 default E potion Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(11)
2:32.396 default G use_items Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(11), battle_potion_of_intellect
2:32.396 default N sunfire Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse
2:33.332 default O moonfire enemy3 92.0/100: 92% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse
2:34.271 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
2:35.167 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
2:35.922 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
2:36.796 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
2:37.550 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
2:38.628 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
2:39.381 default P lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(2)
2:40.468 default O moonfire enemy2 67.5/100: 68% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
2:41.292 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(3)
2:42.047 default P lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
2:43.101 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
2:43.101 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
2:44.008 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
2:44.763 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
2:45.614 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
2:46.368 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
2:47.427 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
2:48.262 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
2:49.020 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
2:50.021 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
2:50.811 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
2:51.603 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
2:52.359 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
2:53.372 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(5), conch_of_dark_whispers, battle_potion_of_intellect
2:54.197 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers, battle_potion_of_intellect
2:55.437 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers, battle_potion_of_intellect
2:56.413 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers, battle_potion_of_intellect
2:57.247 default M moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power, battle_potion_of_intellect
2:58.233 default O moonfire enemy3 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
2:59.369 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
3:00.817 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
3:02.265 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
3:03.594 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), solar_empowerment(3), overwhelming_power(23)
3:04.562 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(2), solar_empowerment(2), overwhelming_power(22)
3:05.705 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(21)
3:06.652 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20)
3:08.078 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(18)
3:09.202 default I fury_of_elune Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(17)
3:10.301 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16)
3:11.404 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(15)
3:12.345 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14)
3:13.760 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(4), fury_of_elune, solar_empowerment(3), starlord(2), overwhelming_power(13)
3:14.708 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12)
3:15.827 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
3:16.755 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
3:18.151 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
3:19.254 default O moonfire enemy3 28.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
3:20.361 default O moonfire enemy2 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers
3:21.475 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), conch_of_dark_whispers
3:22.423 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
3:23.850 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
3:24.803 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), overwhelming_power(25), conch_of_dark_whispers
3:26.245 default N sunfire Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), overwhelming_power(23), conch_of_dark_whispers
3:27.386 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), overwhelming_power(22), conch_of_dark_whispers
3:28.359 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), overwhelming_power(21), conch_of_dark_whispers
3:29.510 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(20), conch_of_dark_whispers
3:30.460 default P lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(24), conch_of_dark_whispers
3:31.866 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
3:32.974 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
3:33.890 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
3:35.272 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
3:36.364 default F berserking Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
3:36.364 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power berserking, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
3:37.120 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power berserking, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
3:38.195 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
3:39.044 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
3:39.797 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
3:40.881 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
3:41.636 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13)
3:42.493 default O moonfire enemy3 1.0/100: 1% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
3:43.482 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11)
3:44.475 default O moonfire Fluffy_Pillow 8.5/100: 9% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10)
3:45.473 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9)
3:46.747 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power berserking, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8)
3:47.600 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
3:48.883 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), overwhelming_power(6)
3:50.093 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(4)
3:51.101 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(3)
3:52.615 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(2)
3:54.133 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord
3:55.155 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord
3:56.359 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:57.353 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:58.842 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
4:00.330 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
4:01.499 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
4:02.636 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
4:03.602 default O moonfire enemy2 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
4:04.739 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
4:06.186 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
4:07.153 default O moonfire enemy3 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3)
4:08.290 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3)
4:09.737 default I fury_of_elune Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), solar_empowerment(2)
4:10.975 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(5), fury_of_elune, solar_empowerment(2)
4:12.214 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord
4:13.236 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
4:14.437 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
4:15.430 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:16.917 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:18.085 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:19.052 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:20.499 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:21.635 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:23.082 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:24.047 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:25.014 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:26.716 default O moonfire Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:27.853 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
4:28.820 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
4:28.820 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(8), torrent_of_elements
4:30.058 default O moonfire enemy3 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:31.106 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:32.153 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:33.017 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
4:34.032 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:34.873 default L sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
4:35.861 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
4:37.307 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
4:38.754 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
4:39.889 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:40.854 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:42.301 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
4:43.748 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:45.194 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:46.162 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements
4:47.129 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements
4:48.575 default P lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements
4:50.278 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(3), torrent_of_elements
4:51.515 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:52.719 default O moonfire enemy3 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:53.889 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:55.058 default O moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:56.225 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:57.713 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:59.201 default H celestial_alignment Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2)
5:00.217 default G use_items Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2)
5:00.217 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), ignition_mages_fuse
5:01.191 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse
5:01.995 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
5:02.944 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse
5:03.750 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse
5:04.957 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
5:05.729 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
5:06.886 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
5:07.659 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
5:08.568 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 5.88% 5.88% 500
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

worldvein : 63362 dps, 39513 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
63362.5 63362.5 60.4 / 0.095% 6482.5 / 10.2% 7896.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 7.9 Astral Power 0.00% 57.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 63362
Fury of Elune 2755 4.3% 5.3 60.78sec 154085 152048 Direct 388.1 1789 3574 2119 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 388.12 142.27 0.00 1.0135 0.2962 822577.17 822577.17 0.00 17300.30 152047.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 316.23 81.48% 1788.70 1486 2133 1790.29 1653 1952 565639 565639 0.00
crit 71.89 18.52% 3574.17 2972 4267 3577.00 3286 4016 256938 256938 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 296 (677) 0.5% (1.1%) 8.2 32.87sec 24816 0 Direct 8.2 9134 18264 10836 18.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 88525.50 88525.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.65 81.35% 9133.87 8921 9813 9131.62 0 9813 60703 60703 0.00
crit 1.52 18.65% 18263.58 17842 19626 14522.17 0 19626 27822 27822 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 381 0.6% 8.2 32.87sec 13979 0 Direct 24.5 3914 7831 4659 19.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 24.51 0.00 0.00 0.0000 0.0000 114200.44 114200.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.84 80.96% 3914.10 3823 4206 3914.05 3823 4206 77665 77665 0.00
crit 4.67 19.04% 7830.84 7646 8411 7673.89 0 8411 36535 36535 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 10708 16.9% 84.8 3.49sec 37819 28274 Direct 254.3 10622 21251 12607 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.75 254.25 0.00 0.00 1.3376 0.0000 3205172.53 3205172.53 0.00 28274.28 28274.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 206.77 81.32% 10621.57 3345 25993 10628.42 9549 11805 2196183 2196183 0.00
crit 47.48 18.68% 21250.96 6689 51987 21254.62 14439 27652 1008989 1008989 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 10257 16.2% 27.3 10.91sec 112366 108533 Direct 54.6 3777 7559 4485 18.7%  
Periodic 666.4 3568 7132 4236 18.7% 296.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.30 54.61 666.43 666.43 1.0353 1.3331 3068012.22 3068012.22 0.00 3346.95 108533.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.38 81.27% 3776.71 3280 4801 3777.46 3591 4036 167607 167607 0.00
crit 10.23 18.73% 7559.15 6689 9602 7559.41 7004 8997 77319 77319 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 541.5 81.25% 3567.85 5 4470 3569.40 3481 3717 1931930 1931930 0.00
crit 124.9 18.75% 7132.37 32 8940 7134.87 6852 7634 891157 891157 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 2999 (9247) 4.7% (14.6%) 79.6 3.66sec 34729 39792 Direct 80.3 9411 18822 11172 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.65 80.26 0.00 0.00 0.8728 0.0000 896671.18 896671.18 0.00 39792.41 39792.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.23 81.28% 9410.73 7949 11636 9415.85 9135 9812 613881 613881 0.00
crit 15.02 18.72% 18821.78 15898 23272 18830.08 17349 21067 282790 282790 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 6248 9.9% 74.6 3.89sec 25064 0 Direct 223.8 8354 0 8354 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.58 223.75 0.00 0.00 0.0000 0.0000 1869338.75 1869338.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.75 100.00% 8353.87 5962 17454 8360.02 7399 9666 1869339 1869339 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6434.30
  • base_dd_max:6434.30
  • base_dd_mult:1.00
 
Starsurge 14215 22.4% 60.0 5.01sec 70870 67999 Direct 59.8 60005 119942 71126 18.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.97 59.76 0.00 0.00 1.0422 0.0000 4249967.73 4249967.73 0.00 67999.48 67999.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.67 81.45% 60004.80 52283 74359 60033.93 57997 62614 2920562 2920562 0.00
crit 11.08 18.55% 119941.77 104566 148718 119970.16 0 140021 1329406 1329406 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5891 9.2% 90.1 3.08sec 19441 0 Direct 90.1 16394 32795 19442 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.11 90.11 0.00 0.00 0.0000 0.0000 1751816.83 1751816.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.36 81.42% 16393.52 16021 17623 16393.97 16021 17247 1202670 1202670 0.00
crit 16.74 18.58% 32794.93 32042 35246 32792.68 32042 34890 549147 549147 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 9612 15.2% 18.1 16.72sec 158512 156219 Direct 18.1 4827 9665 5746 19.0%  
Periodic 669.8 3483 6966 4136 18.7% 298.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.13 18.13 669.81 669.81 1.0147 1.3323 2874589.64 2874589.64 0.00 3156.13 156219.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.69 81.01% 4826.74 4112 6020 4827.38 4504 5161 70911 70911 0.00
crit 3.44 18.99% 9665.41 8387 12040 9420.37 0 12040 33282 33282 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 544.3 81.26% 3483.30 8 4364 3484.77 3400 3621 1895827 1895827 0.00
crit 125.6 18.74% 6965.72 15 8729 6968.04 6671 7322 874570 874570 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.43sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.26sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8979 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 52.7 45.0sec 5.0sec 93.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.40%
  • arcanic_pulsar_2:11.12%
  • arcanic_pulsar_3:11.43%
  • arcanic_pulsar_4:9.48%
  • arcanic_pulsar_5:13.95%
  • arcanic_pulsar_6:11.37%
  • arcanic_pulsar_7:9.58%
  • arcanic_pulsar_8:15.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.3sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.3sec 182.3sec 8.12% 7.88% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.72% 34.10% 0.0(0.0) 8.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.4sec 45.1sec 23.86% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 14.08% 0.00% 84.3(84.3) 5.2

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 88.7 0.0 149.8sec 3.3sec 98.22% 0.00% 74.9(79.1) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.43%
  • lifeblood_2:2.23%
  • lifeblood_3:6.38%
  • lifeblood_4:88.18%

Trigger Attempt Success

  • trigger_pct:94.14%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.7 42.3 9.0sec 3.9sec 78.88% 85.95% 1.9(1.9) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.71%
  • lunar_empowerment_2:27.85%
  • lunar_empowerment_3:14.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 398.8(398.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.6sec 34.0sec 47.81% 0.00% 3.4(47.6) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.2 49.9 10.9sec 3.9sec 84.66% 92.91% 0.2(0.2) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.38%
  • solar_empowerment_2:38.52%
  • solar_empowerment_3:15.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 44.8 20.4sec 5.0sec 97.14% 92.39% 14.9(14.9) 12.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:16.23%
  • starlord_2:21.79%
  • starlord_3:59.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.7sec 45.3sec 23.89% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.89%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.0 2398.7 40.0 40.0 1771.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 80.65 644.86 (27.30%) 8.00 0.32 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.39%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.25 210.56 (8.91%) 2.50 0.06 0.03%
sunfire Astral Power 18.14 54.41 (2.30%) 3.00 0.00 0.00%
moonfire Astral Power 27.30 81.91 (3.47%) 3.00 0.00 0.00%
lunar_strike Astral Power 84.75 1016.62 (43.04%) 12.00 0.38 0.04%
natures_balance Astral Power 399.85 199.91 (8.46%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.16 73.87 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.89 8.01
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.65 0.00 71.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data worldvein Damage Per Second
Count 2990
Mean 63362.49
Minimum 58657.70
Maximum 68806.15
Spread ( max - min ) 10148.45
Range [ ( max - min ) / 2 * 100% ] 8.01%
Standard Deviation 1686.0439
5th Percentile 60639.68
95th Percentile 66269.47
( 95th Percentile - 5th Percentile ) 5629.79
Mean Distribution
Standard Deviation 30.8342
95.00% Confidence Intervall ( 63302.05 - 63422.92 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2721
0.1 Scale Factor Error with Delta=300 24268
0.05 Scale Factor Error with Delta=300 97070
0.01 Scale Factor Error with Delta=300 2426730
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 2990
Mean 39512.92
Minimum 36130.83
Maximum 43766.77
Spread ( max - min ) 7635.94
Range [ ( max - min ) / 2 * 100% ] 9.66%
Standard Deviation 1244.9297
5th Percentile 37569.52
95th Percentile 41705.74
( 95th Percentile - 5th Percentile ) 4136.22
Mean Distribution
Standard Deviation 22.7672
95.00% Confidence Intervall ( 39468.30 - 39557.54 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3814
0.1 Scale Factor Error with Delta=300 13231
0.05 Scale Factor Error with Delta=300 52922
0.01 Scale Factor Error with Delta=300 1323042
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 2990
Mean 63362.49
Minimum 58657.70
Maximum 68806.15
Spread ( max - min ) 10148.45
Range [ ( max - min ) / 2 * 100% ] 8.01%
Damage
Sample Data worldvein Damage
Count 2990
Mean 18940872.00
Minimum 14936564.82
Maximum 23474417.93
Spread ( max - min ) 8537853.12
Range [ ( max - min ) / 2 * 100% ] 22.54%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.34 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.13 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.97 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.02 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.84 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 24.46 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 85.13 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 79.86 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.53 sunfire

Sample Sequence

012345678ACDKNOOPHFGIKQKQPKQPKQNQPQPOQRKQKQPKLOPPQPQQPQKQPQJKQKQLOPKPPKOPQPQPQKNPKPOIQKPQKOQPQNKQKQPQLPKOPPQKOPQPKPQQNKPQQPKOPQPOQPKNPKPGIQQKQKQPQPOPNOKKQPQPKQPQKPQQPNOPOKPKQPQPQKQPNQQOPPKQKQFQILOPKHEKQPKQPQPJKOKQPKNQPQPKOPPPQQPKQKQPKLOPPPKOPQPQQKNPGKIOPQKQPKQPOQNQPKPKQPKQPLOPKPQQQPOPKPKPQNQKPOQPKPQPOKPIQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.163 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.089 default O moonfire enemy2 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.017 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood, battle_potion_of_intellect
0:05.195 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, lifeblood(2), battle_potion_of_intellect
0:05.999 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, lifeblood(2), battle_potion_of_intellect
0:05.999 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, lifeblood(2), battle_potion_of_intellect
0:05.999 default I fury_of_elune Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.752 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment(2), starlord, lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.508 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.262 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.016 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.770 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.617 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.372 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.126 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.935 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.691 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.445 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.197 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.952 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.730 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.484 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.263 default O moonfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.020 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.775 default R sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.530 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.283 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.038 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.793 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.547 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), lifeblood(4), ignition_mages_fuse(5)
0:24.362 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4), ignition_mages_fuse(5)
0:25.116 default L sunfire Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(5)
0:25.871 default O moonfire enemy3 8.0/100: 8% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(5)
0:26.626 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
0:27.741 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
0:28.855 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers
0:29.608 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
0:30.723 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
0:31.479 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:32.232 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(8), starlord(3), lifeblood(4), conch_of_dark_whispers
0:33.540 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(8), starlord(3), lifeblood(4), conch_of_dark_whispers
0:34.415 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, arcanic_pulsar(8), starlord(3), lifeblood(4), conch_of_dark_whispers
0:35.292 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:36.046 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:37.015 default Q solar_wrath Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, celestial_alignment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:37.776 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:37.776 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, celestial_alignment, lunar_empowerment, lifeblood(4), conch_of_dark_whispers
0:38.604 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
0:39.357 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
0:40.163 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers
0:40.919 default L sunfire Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(2), lifeblood(4), conch_of_dark_whispers
0:41.702 default O moonfire enemy2 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(2), lifeblood(4), conch_of_dark_whispers
0:42.871 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(2), lifeblood(4), conch_of_dark_whispers
0:44.359 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:45.528 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:46.976 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:48.424 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:49.561 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:50.697 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:52.146 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:53.113 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
0:54.560 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:55.527 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:56.974 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:57.940 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(4), torrent_of_elements, lifeblood(4)
0:59.176 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
1:00.379 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
1:01.911 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment, starlord, lifeblood(4)
1:03.112 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
1:04.602 default O moonfire enemy3 25.0/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), lifeblood(4)
1:05.772 default I fury_of_elune Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), lifeblood(4)
1:07.167 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(2), lifeblood(4)
1:08.161 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment, starlord(2), lifeblood(4)
1:09.328 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:10.774 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(3), starlord(3), lifeblood(4)
1:11.740 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(3), lifeblood(4)
1:12.876 default O moonfire enemy2 14.0/100: 14% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
1:14.013 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
1:14.980 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:16.427 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(4)
1:17.391 default N sunfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4)
1:18.528 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), solar_empowerment, lifeblood(4)
1:19.767 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
1:20.657 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
1:21.704 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
1:22.569 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4)
1:23.864 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25), lifeblood(4)
1:24.654 default L sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4)
1:25.587 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(2), overwhelming_power(23), lifeblood(4)
1:26.959 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), overwhelming_power(22), lifeblood(4)
1:28.038 default O moonfire enemy3 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4)
1:29.097 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), lifeblood(4)
1:30.448 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(2)
1:31.805 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(2)
1:32.714 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(16), lifeblood(4)
1:33.787 default O moonfire enemy2 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), lifeblood(4)
1:34.866 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), lifeblood(4)
1:36.242 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(12), lifeblood(4)
1:37.167 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(11), lifeblood(4)
1:38.555 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), overwhelming_power(10), lifeblood(4)
1:39.749 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), lifeblood(4)
1:41.231 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, overwhelming_power(24), lifeblood(4)
1:42.170 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(23), lifeblood(4)
1:43.111 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), starlord, overwhelming_power(22), lifeblood(4)
1:44.222 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), starlord, overwhelming_power(21), lifeblood(4)
1:45.335 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(20), lifeblood(4)
1:46.720 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(19), lifeblood(4)
1:47.648 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(18), lifeblood(4)
1:48.579 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), starlord(2), overwhelming_power(17), lifeblood(4)
1:50.224 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), starlord(2), overwhelming_power(15), lifeblood(4)
1:51.330 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), lifeblood(4)
1:52.408 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4)
1:53.788 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(12), lifeblood(4)
1:54.713 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(11), lifeblood(4)
1:56.349 default O moonfire enemy3 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(9), lifeblood(4)
1:57.450 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(8), lifeblood(4)
1:58.389 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(7), lifeblood(4)
2:00.048 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(6), overwhelming_power(5), lifeblood(4)
2:01.264 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4), lifeblood(4)
2:02.446 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(3), lifeblood(4)
2:03.959 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), lifeblood(4)
2:05.153 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
2:06.642 default G use_items Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
2:06.642 default I fury_of_elune Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse
2:07.762 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse
2:08.714 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse
2:09.665 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), fury_of_elune, starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse
2:10.784 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:11.557 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:12.468 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:13.240 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:14.396 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:15.305 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
2:16.416 default O moonfire enemy2 62.5/100: 63% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
2:17.420 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(3)
2:18.699 default N sunfire Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
2:19.664 default O moonfire Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar, solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
2:20.629 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar, solar_empowerment, lifeblood(4), ignition_mages_fuse(4)
2:21.681 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), ignition_mages_fuse(4)
2:22.701 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4), ignition_mages_fuse(5)
2:23.518 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(5)
2:24.736 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(4), ignition_mages_fuse(5)
2:25.550 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(5)
2:26.768 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), lifeblood(4)
2:27.936 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
2:28.903 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(4)
2:30.227 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4)
2:31.117 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4)
2:32.167 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4)
2:33.508 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4)
2:34.407 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(19), lifeblood(4)
2:35.310 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4)
2:36.665 default N sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(17), lifeblood(4)
2:37.734 default O moonfire enemy2 49.0/100: 49% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(16), lifeblood(4)
2:38.806 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(15), lifeblood(4)
2:40.418 default O moonfire Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4)
2:41.502 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(12), lifeblood(4)
2:42.687 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11), lifeblood(4)
2:44.158 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(9), lifeblood(4)
2:45.321 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8), lifeblood(4)
2:46.285 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), lifeblood(4)
2:47.735 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(6), lifeblood(4)
2:48.708 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), lifeblood(4)
2:50.169 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(3), lifeblood(4)
2:51.151 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(2), lifeblood(4)
2:52.311 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power, lifeblood(4)
2:53.273 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
2:54.722 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
2:55.861 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
2:56.827 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
2:57.794 default O moonfire enemy2 59.5/100: 60% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4), conch_of_dark_whispers
2:58.930 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4), conch_of_dark_whispers
3:00.632 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4), conch_of_dark_whispers
3:02.336 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment, lifeblood(4), conch_of_dark_whispers
3:03.574 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
3:04.463 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
3:05.510 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers
3:06.373 default F berserking Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers
3:06.373 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers
3:07.159 default I fury_of_elune Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), lifeblood(4), conch_of_dark_whispers
3:08.083 default L sunfire Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(2), lifeblood(4), conch_of_dark_whispers
3:09.007 default O moonfire enemy3 60.5/100: 61% astral_power berserking, arcanic_pulsar, fury_of_elune, lunar_empowerment(3), starlord(2), lifeblood(4)
3:10.069 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power berserking, arcanic_pulsar, fury_of_elune, lunar_empowerment(3), starlord(2), lifeblood(4)
3:11.422 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power berserking, arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(2), lifeblood(3)
3:12.482 default H celestial_alignment Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(3)
3:13.307 default E potion Fluffy_Pillow 100.0/100: 100% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4)
3:13.307 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect
3:14.130 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:14.883 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:15.937 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect
3:16.767 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:17.522 default P lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), battle_potion_of_intellect
3:18.587 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), lifeblood(4), battle_potion_of_intellect
3:19.371 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4), battle_potion_of_intellect
3:20.551 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4), battle_potion_of_intellect
3:20.551 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, overwhelming_power(17), lifeblood(4), battle_potion_of_intellect
3:21.565 default O moonfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16), lifeblood(4), battle_potion_of_intellect
3:22.552 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(15), lifeblood(4), battle_potion_of_intellect
3:23.544 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:24.365 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(13), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:25.598 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:26.571 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:27.520 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:28.330 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:29.549 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:30.365 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(7), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:31.594 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(6), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:32.561 default O moonfire enemy2 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:33.677 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:35.105 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:36.543 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:37.985 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:38.953 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4)
3:39.920 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4)
3:41.622 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), lifeblood(4)
3:42.860 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
3:43.749 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power celestial_alignment, lunar_empowerment, starlord, lifeblood(4)
3:44.796 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4)
3:45.661 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), lifeblood(4)
3:46.956 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), lifeblood(4)
3:47.972 default L sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4)
3:48.961 default O moonfire enemy3 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4)
3:50.098 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4)
3:51.546 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
3:52.995 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
3:54.441 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
3:55.577 default O moonfire enemy2 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
3:56.715 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
3:58.161 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
3:59.127 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
4:00.575 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
4:01.542 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
4:02.507 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), lifeblood(4), conch_of_dark_whispers
4:03.744 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
4:04.945 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
4:06.478 default G use_items Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
4:06.478 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:07.628 default I fury_of_elune Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:08.747 default O moonfire enemy3 13.0/100: 13% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:09.868 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:11.294 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), fury_of_elune, solar_empowerment(3), starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.205 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), fury_of_elune, solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.279 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.169 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.500 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.504 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:17.356 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:18.634 default O moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:19.600 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:20.421 default N sunfire Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), ignition_mages_fuse(4)
4:21.319 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(4), ignition_mages_fuse(4)
4:22.080 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(24), lifeblood(4), ignition_mages_fuse(4)
4:23.425 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(7), overwhelming_power(23), lifeblood(4), ignition_mages_fuse(5)
4:24.373 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), lifeblood(4), ignition_mages_fuse(5)
4:25.549 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(21), lifeblood(4), ignition_mages_fuse(5)
4:26.475 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), lifeblood(4), ignition_mages_fuse(5)
4:27.229 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(19), lifeblood(4)
4:28.436 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(18), lifeblood(4)
4:29.388 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
4:30.177 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4)
4:31.364 default L sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), lifeblood(4)
4:32.301 default O moonfire enemy3 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
4:33.342 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4)
4:34.674 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
4:35.725 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4)
4:37.065 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(4)
4:37.966 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(4)
4:38.869 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(4)
4:39.774 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood(4)
4:41.374 default O moonfire enemy2 57.0/100: 57% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood(4)
4:42.451 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(4)
4:44.068 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(12), lifeblood(4)
4:45.255 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11), lifeblood(4)
4:46.726 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), lifeblood(2)
4:47.885 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(2)
4:49.324 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(7), lifeblood(3)
4:50.291 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(6), lifeblood(4)
4:51.435 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(5), lifeblood(3)
4:52.411 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(4), lifeblood(3)
4:53.561 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3), lifeblood(4)
4:54.992 default O moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(2), lifeblood(4)
4:56.121 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), lifeblood(4)
4:57.087 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
4:58.790 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
4:59.927 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4)
5:01.375 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), lifeblood(4)
5:02.342 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4)
5:03.789 default O moonfire enemy2 37.0/100: 37% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(4)
5:04.926 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), solar_empowerment, lifeblood(4)
5:06.165 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
5:07.696 default I fury_of_elune Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, lifeblood(4)
5:08.899 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

Simulation & Raid Information

Iterations: 2996
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.5 )

Performance:

Total Events Processed: 122980506
Max Event Queue: 530
Sim Seconds: 897319
CPU Seconds: 191.2188
Physical Seconds: 39.8874
Speed Up: 4693

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.29sec 0 299.51sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.14sec 0 299.51sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
base base fury_of_elune 202770 773421 2582 77.85 1681 3354 5.3 388.6 18.5% 0.0% 0.0% 0.0% 60.75sec 773421 299.51sec
base base heed_my_call 271685 89123 298 1.65 9130 18260 8.2 8.2 18.7% 0.0% 0.0% 0.0% 33.18sec 89123 299.51sec
base base heed_my_call_aoe 271686 114590 383 4.94 3913 7823 8.2 24.7 18.7% 0.0% 0.0% 0.0% 33.18sec 114590 299.51sec
base base lunar_strike 194153 2984750 9966 50.98 9898 19703 84.8 254.5 18.7% 0.0% 0.0% 0.0% 3.49sec 2984750 299.51sec
base base moonfire 8921 228655 763 10.94 3527 7050 27.3 54.6 18.7% 0.0% 0.0% 0.0% 10.90sec 2857376 299.51sec
base base moonfire ticks -8921 2628721 8762 133.30 3324 6644 27.3 666.5 18.7% 0.0% 0.0% 0.0% 10.90sec 2857376 299.51sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
base base solar_wrath 190984 835043 2788 16.06 8770 17554 79.6 80.2 18.7% 0.0% 0.0% 0.0% 3.68sec 835043 299.51sec
base base solar_empowerment 279729 1740179 5810 44.82 7779 0 74.6 223.7 0.0% 0.0% 0.0% 0.0% 3.90sec 1740179 299.51sec
base base starsurge 78674 3997992 13349 11.97 56275 112449 60.0 59.8 18.9% 0.0% 0.0% 0.0% 5.01sec 3997992 299.51sec
base base streaking_stars 272873 1751426 5848 18.05 16394 32796 90.1 90.1 18.6% 0.0% 0.0% 0.0% 3.08sec 1751426 299.51sec
base base sunfire 93402 96717 323 3.63 4506 9018 18.1 18.1 18.3% 0.0% 0.0% 0.0% 16.71sec 2678031 299.51sec
base base sunfire ticks -93402 2581314 8604 133.97 3246 6489 18.1 669.9 18.7% 0.0% 0.0% 0.0% 16.71sec 2678031 299.51sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.83sec 0 299.51sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.79sec 0 299.51sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
blood of the enemy blood of the enemy fury_of_elune 202770 807437 2696 79.49 1688 3372 5.3 396.8 20.6% 0.0% 0.0% 0.0% 60.81sec 807437 299.51sec
blood of the enemy blood of the enemy heed_my_call 271685 92114 308 1.67 9124 18255 8.3 8.3 21.0% 0.0% 0.0% 0.0% 32.36sec 92114 299.51sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 118580 396 5.01 3911 7821 8.3 25.0 21.1% 0.0% 0.0% 0.0% 32.36sec 118580 299.51sec
blood of the enemy blood of the enemy lunar_strike 194153 3086219 10304 51.87 9870 19737 86.3 258.9 20.8% 0.0% 0.0% 0.0% 3.43sec 3086219 299.51sec
blood of the enemy blood of the enemy moonfire 8921 232697 777 10.96 3524 7053 27.4 54.7 20.6% 0.0% 0.0% 0.0% 10.88sec 2952072 299.51sec
blood of the enemy blood of the enemy moonfire ticks -8921 2719376 9065 135.38 3324 6645 27.4 676.9 20.9% 0.0% 0.0% 0.0% 10.88sec 2952072 299.51sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
blood of the enemy blood of the enemy solar_wrath 190984 865181 2889 16.35 8768 17556 81.0 81.6 20.9% 0.0% 0.0% 0.0% 3.61sec 865181 299.51sec
blood of the enemy blood of the enemy solar_empowerment 279729 1799515 6008 45.52 7919 0 75.7 227.2 0.0% 0.0% 0.0% 0.0% 3.84sec 1799515 299.51sec
blood of the enemy blood of the enemy starsurge 78674 4104969 13706 12.12 56270 112400 60.7 60.5 20.6% 0.0% 0.0% 0.0% 4.95sec 4104969 299.51sec
blood of the enemy blood of the enemy streaking_stars 272873 1813745 6056 18.36 16389 32780 91.6 91.6 20.8% 0.0% 0.0% 0.0% 3.03sec 1813745 299.51sec
blood of the enemy blood of the enemy sunfire 93402 98267 328 3.63 4507 9012 18.1 18.1 20.5% 0.0% 0.0% 0.0% 16.80sec 2766518 299.51sec
blood of the enemy blood of the enemy sunfire ticks -93402 2668251 8894 136.06 3246 6489 18.1 680.3 20.9% 0.0% 0.0% 0.0% 16.80sec 2766518 299.51sec
crucible of flame crucible of flame ancient_flame ticks -295367 384692 1282 21.71 2984 5969 25.2 108.5 18.8% 0.0% 0.0% 0.0% 11.59sec 384692 299.51sec
crucible of flame crucible of flame augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
crucible of flame crucible of flame berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.42sec 0 299.51sec
crucible of flame crucible of flame celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.12sec 0 299.51sec
crucible of flame crucible of flame flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
crucible of flame crucible of flame food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
crucible of flame crucible of flame fury_of_elune 202770 772957 2581 77.80 1680 3354 5.3 388.3 18.5% 0.0% 0.0% 0.0% 60.78sec 772957 299.51sec
crucible of flame crucible of flame heed_my_call 271685 89696 299 1.66 9132 18260 8.3 8.3 18.7% 0.0% 0.0% 0.0% 32.91sec 89696 299.51sec
crucible of flame crucible of flame heed_my_call_aoe 271686 115459 385 4.97 3913 7829 8.3 24.8 18.9% 0.0% 0.0% 0.0% 32.91sec 115459 299.51sec
crucible of flame crucible of flame lunar_strike 194153 2986653 9972 50.98 9883 19788 84.8 254.5 18.7% 0.0% 0.0% 0.0% 3.49sec 2986653 299.51sec
crucible of flame crucible of flame moonfire 8921 228179 762 10.93 3523 7045 27.3 54.6 18.7% 0.0% 0.0% 0.0% 10.91sec 2855642 299.51sec
crucible of flame crucible of flame moonfire ticks -8921 2627463 8758 133.32 3323 6639 27.3 666.6 18.7% 0.0% 0.0% 0.0% 10.91sec 2855642 299.51sec
crucible of flame crucible of flame moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
crucible of flame crucible of flame potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
crucible of flame crucible of flame solar_wrath 190984 834712 2787 16.07 8767 17534 79.6 80.2 18.7% 0.0% 0.0% 0.0% 3.68sec 834712 299.51sec
crucible of flame crucible of flame solar_empowerment 279729 1738986 5806 44.83 7772 0 74.6 223.8 0.0% 0.0% 0.0% 0.0% 3.91sec 1738986 299.51sec
crucible of flame crucible of flame starsurge 78674 3985270 13306 11.97 56246 112385 60.0 59.8 18.6% 0.0% 0.0% 0.0% 5.01sec 3985270 299.51sec
crucible of flame crucible of flame streaking_stars 272873 1751246 5847 18.05 16381 32773 90.1 90.1 18.6% 0.0% 0.0% 0.0% 3.08sec 1751246 299.51sec
crucible of flame crucible of flame sunfire 93402 97032 324 3.64 4506 9011 18.1 18.1 18.7% 0.0% 0.0% 0.0% 16.71sec 2676289 299.51sec
crucible of flame crucible of flame sunfire ticks -93402 2579257 8598 133.98 3245 6487 18.1 669.9 18.7% 0.0% 0.0% 0.0% 16.71sec 2676289 299.51sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.59sec 0 299.51sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.39sec 0 299.51sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
focusing iris focusing iris fury_of_elune 202770 822623 2747 82.82 1680 3355 5.3 413.4 18.5% 0.0% 0.0% 0.0% 60.75sec 822623 299.51sec
focusing iris focusing iris heed_my_call 271685 91619 306 1.70 9129 18275 8.5 8.5 18.6% 0.0% 0.0% 0.0% 31.83sec 91619 299.51sec
focusing iris focusing iris heed_my_call_aoe 271686 117592 393 5.09 3913 7827 8.5 25.4 18.4% 0.0% 0.0% 0.0% 31.83sec 117592 299.51sec
focusing iris focusing iris lunar_strike 194153 3104124 10364 53.26 9841 19596 88.6 265.9 18.8% 0.0% 0.0% 0.0% 3.34sec 3104124 299.51sec
focusing iris focusing iris moonfire 8921 230220 769 11.04 3521 7037 27.6 55.1 18.7% 0.0% 0.0% 0.0% 10.81sec 2963185 299.51sec
focusing iris focusing iris moonfire ticks -8921 2732965 9110 138.43 3327 6652 27.6 692.2 18.7% 0.0% 0.0% 0.0% 10.81sec 2963185 299.51sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
focusing iris focusing iris solar_wrath 190984 865266 2889 16.65 8780 17550 82.5 83.1 18.6% 0.0% 0.0% 0.0% 3.54sec 865266 299.51sec
focusing iris focusing iris solar_empowerment 279729 1799730 6009 46.33 7782 0 77.1 231.3 0.0% 0.0% 0.0% 0.0% 3.77sec 1799730 299.51sec
focusing iris focusing iris starsurge 78674 4102392 13697 12.33 56204 112263 61.8 61.5 18.6% 0.0% 0.0% 0.0% 4.87sec 4102392 299.51sec
focusing iris focusing iris streaking_stars 272873 1811328 6048 18.66 16389 32797 93.1 93.1 18.7% 0.0% 0.0% 0.0% 3.00sec 1811328 299.51sec
focusing iris focusing iris sunfire 93402 97026 324 3.63 4517 9013 18.1 18.1 18.6% 0.0% 0.0% 0.0% 16.74sec 2779537 299.51sec
focusing iris focusing iris sunfire ticks -93402 2682511 8942 139.14 3249 6495 18.1 695.7 18.7% 0.0% 0.0% 0.0% 16.74sec 2779537 299.51sec
life-force life-force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
life-force life-force azerite_spike 295835 261372 873 3.33 13238 26494 16.6 16.6 18.7% 0.0% 0.0% 0.0% 17.42sec 261372 299.51sec
life-force life-force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.26sec 0 299.51sec
life-force life-force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.15sec 0 299.51sec
life-force life-force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
life-force life-force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
life-force life-force fury_of_elune 202770 776994 2594 77.79 1689 3375 5.3 388.3 18.5% 0.0% 0.0% 0.0% 60.76sec 776994 299.51sec
life-force life-force heed_my_call 271685 89404 299 1.64 9184 18369 8.2 8.2 18.6% 0.0% 0.0% 0.0% 33.54sec 89404 299.51sec
life-force life-force heed_my_call_aoe 271686 114954 384 4.93 3931 7861 8.2 24.6 18.8% 0.0% 0.0% 0.0% 33.54sec 114954 299.51sec
life-force life-force lunar_strike 194153 3001559 10022 50.97 9935 19896 84.8 254.4 18.7% 0.0% 0.0% 0.0% 3.49sec 3001559 299.51sec
life-force life-force moonfire 8921 229805 767 10.94 3544 7089 27.3 54.6 18.7% 0.0% 0.0% 0.0% 10.91sec 2871429 299.51sec
life-force life-force moonfire ticks -8921 2641623 8805 133.27 3340 6676 27.3 666.4 18.7% 0.0% 0.0% 0.0% 10.91sec 2871429 299.51sec
life-force life-force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
life-force life-force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
life-force life-force solar_wrath 190984 838885 2801 16.05 8819 17656 79.5 80.1 18.7% 0.0% 0.0% 0.0% 3.68sec 838885 299.51sec
life-force life-force solar_empowerment 279729 1746213 5830 44.74 7818 0 74.4 223.3 0.0% 0.0% 0.0% 0.0% 3.91sec 1746213 299.51sec
life-force life-force starsurge 78674 4010878 13392 11.97 56591 113186 60.0 59.8 18.6% 0.0% 0.0% 0.0% 5.02sec 4010878 299.51sec
life-force life-force streaking_stars 272873 1763584 5888 18.05 16505 33007 90.1 90.1 18.6% 0.0% 0.0% 0.0% 3.08sec 1763584 299.51sec
life-force life-force sunfire 93402 97558 326 3.64 4532 9083 18.1 18.1 18.5% 0.0% 0.0% 0.0% 16.72sec 2690935 299.51sec
life-force life-force sunfire ticks -93402 2593377 8645 133.94 3263 6519 18.1 669.7 18.7% 0.0% 0.0% 0.0% 16.72sec 2690935 299.51sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.72sec 0 299.51sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.52sec 0 299.51sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
lucid dreams lucid dreams fury_of_elune 202770 808312 2699 80.42 1698 3392 5.3 401.4 18.6% 0.0% 0.0% 0.0% 60.80sec 808312 299.51sec
lucid dreams lucid dreams heed_my_call 271685 89744 300 1.64 9213 18414 8.2 8.2 18.7% 0.0% 0.0% 0.0% 32.98sec 89744 299.51sec
lucid dreams lucid dreams heed_my_call_aoe 271686 115375 385 4.93 3948 7896 8.2 24.6 18.7% 0.0% 0.0% 0.0% 32.98sec 115375 299.51sec
lucid dreams lucid dreams lunar_strike 194153 3002603 10025 49.45 10243 20462 82.3 246.8 18.8% 0.0% 0.0% 0.0% 3.59sec 3002603 299.51sec
lucid dreams lucid dreams moonfire 8921 232523 776 11.05 3555 7107 27.6 55.2 18.6% 0.0% 0.0% 0.0% 10.82sec 2897659 299.51sec
lucid dreams lucid dreams moonfire ticks -8921 2665136 8884 133.47 3362 6722 27.6 667.3 18.8% 0.0% 0.0% 0.0% 10.82sec 2897659 299.51sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
lucid dreams lucid dreams solar_wrath 190984 851755 2844 16.22 8856 17715 80.3 81.0 18.8% 0.0% 0.0% 0.0% 3.64sec 851755 299.51sec
lucid dreams lucid dreams solar_empowerment 279729 1819941 6076 46.30 7875 0 77.0 231.1 0.0% 0.0% 0.0% 0.0% 3.77sec 1819941 299.51sec
lucid dreams lucid dreams starsurge 78674 4298820 14353 12.80 56681 113348 64.2 63.9 18.7% 0.0% 0.0% 0.0% 4.70sec 4298820 299.51sec
lucid dreams lucid dreams streaking_stars 272873 1814081 6057 18.46 16585 33185 92.2 92.2 18.7% 0.0% 0.0% 0.0% 3.05sec 1814081 299.51sec
lucid dreams lucid dreams sunfire 93402 98653 329 3.64 4575 9153 18.2 18.2 18.7% 0.0% 0.0% 0.0% 16.69sec 2713269 299.51sec
lucid dreams lucid dreams sunfire ticks -93402 2614616 8715 134.13 3283 6563 18.2 670.7 18.8% 0.0% 0.0% 0.0% 16.69sec 2713269 299.51sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.41sec 0 299.51sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.09sec 0 299.51sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
purification protocol purification protocol fury_of_elune 202770 773137 2581 77.81 1681 3356 5.3 388.4 18.5% 0.0% 0.0% 0.0% 60.78sec 773137 299.51sec
purification protocol purification protocol heed_my_call 271685 89372 298 1.65 9127 18277 8.2 8.2 18.8% 0.0% 0.0% 0.0% 33.36sec 89372 299.51sec
purification protocol purification protocol heed_my_call_aoe 271686 114943 384 4.95 3913 7823 8.2 24.7 18.8% 0.0% 0.0% 0.0% 33.36sec 114943 299.51sec
purification protocol purification protocol lunar_strike 194153 2984257 9964 50.98 9887 19727 84.8 254.5 18.7% 0.0% 0.0% 0.0% 3.49sec 2984257 299.51sec
purification protocol purification protocol moonfire 8921 228033 761 10.94 3524 7042 27.3 54.6 18.5% 0.0% 0.0% 0.0% 10.91sec 2856401 299.51sec
purification protocol purification protocol moonfire ticks -8921 2628368 8761 133.29 3323 6641 27.3 666.4 18.7% 0.0% 0.0% 0.0% 10.91sec 2856401 299.51sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
purification protocol purification protocol purification_protocol 295293 667462 2229 10.04 11226 22460 16.7 50.1 18.6% 0.0% 0.0% 0.0% 17.09sec 667462 299.51sec
purification protocol purification protocol solar_wrath 190984 834307 2786 16.06 8771 17531 79.5 80.2 18.7% 0.0% 0.0% 0.0% 3.66sec 834307 299.51sec
purification protocol purification protocol solar_empowerment 279729 1739169 5807 44.82 7774 0 74.6 223.7 0.0% 0.0% 0.0% 0.0% 3.89sec 1739169 299.51sec
purification protocol purification protocol starsurge 78674 3991170 13326 11.97 56272 112362 60.0 59.8 18.7% 0.0% 0.0% 0.0% 5.01sec 3991170 299.51sec
purification protocol purification protocol streaking_stars 272873 1750241 5844 18.05 16392 32789 90.1 90.1 18.5% 0.0% 0.0% 0.0% 3.08sec 1750241 299.51sec
purification protocol purification protocol sunfire 93402 97043 324 3.64 4508 9008 18.2 18.2 18.5% 0.0% 0.0% 0.0% 16.70sec 2676558 299.51sec
purification protocol purification protocol sunfire ticks -93402 2579516 8598 133.96 3245 6487 18.2 669.8 18.7% 0.0% 0.0% 0.0% 16.70sec 2676558 299.51sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.25sec 0 299.51sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.90sec 0 299.51sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
ripple in space ripple in space fury_of_elune 202770 772784 2580 77.81 1680 3357 5.3 388.4 18.4% 0.0% 0.0% 0.0% 60.73sec 772784 299.51sec
ripple in space ripple in space heed_my_call 271685 88325 295 1.64 9132 18271 8.2 8.2 18.3% 0.0% 0.0% 0.0% 33.06sec 88325 299.51sec
ripple in space ripple in space heed_my_call_aoe 271686 113806 380 4.91 3914 7827 8.2 24.5 18.6% 0.0% 0.0% 0.0% 33.06sec 113806 299.51sec
ripple in space ripple in space lunar_strike 194153 2984457 9965 50.96 9893 19745 84.8 254.4 18.7% 0.0% 0.0% 0.0% 3.48sec 2984457 299.51sec
ripple in space ripple in space moonfire 8921 228424 763 10.95 3526 7054 27.3 54.6 18.6% 0.0% 0.0% 0.0% 10.91sec 2856350 299.51sec
ripple in space ripple in space moonfire ticks -8921 2627926 8760 133.29 3324 6643 27.3 666.4 18.7% 0.0% 0.0% 0.0% 10.91sec 2856350 299.51sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
ripple in space ripple in space solar_wrath 190984 834478 2786 16.07 8772 17531 79.6 80.2 18.6% 0.0% 0.0% 0.0% 3.68sec 834478 299.51sec
ripple in space ripple in space solar_empowerment 279729 1739631 5808 44.85 7770 0 74.6 223.9 0.0% 0.0% 0.0% 0.0% 3.91sec 1739631 299.51sec
ripple in space ripple in space starsurge 78674 3989913 13322 11.97 56279 112411 60.0 59.8 18.7% 0.0% 0.0% 0.0% 5.01sec 3989913 299.51sec
ripple in space ripple in space streaking_stars 272873 1752326 5851 18.05 16397 32796 90.1 90.1 18.6% 0.0% 0.0% 0.0% 3.08sec 1752326 299.51sec
ripple in space ripple in space sunfire 93402 97096 324 3.63 4508 9021 18.1 18.1 18.7% 0.0% 0.0% 0.0% 16.74sec 2677967 299.51sec
ripple in space ripple in space sunfire ticks -93402 2580871 8603 133.97 3246 6490 18.1 669.9 18.7% 0.0% 0.0% 0.0% 16.74sec 2677967 299.51sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.32sec 0 299.51sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.12sec 0 299.51sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
unbound force unbound force fury_of_elune 202770 799580 2670 77.83 1684 3332 5.3 388.5 22.7% 0.0% 0.0% 0.0% 60.76sec 799580 299.51sec
unbound force unbound force heed_my_call 271685 92574 309 1.66 9130 18258 8.3 8.3 22.4% 0.0% 0.0% 0.0% 32.64sec 92574 299.51sec
unbound force unbound force heed_my_call_aoe 271686 119003 397 4.98 3913 7822 8.3 24.9 22.4% 0.0% 0.0% 0.0% 32.64sec 119003 299.51sec
unbound force unbound force lunar_strike 194153 3069348 10248 50.98 9894 19717 84.8 254.5 22.1% 0.0% 0.0% 0.0% 3.48sec 3069348 299.51sec
unbound force unbound force moonfire 8921 235254 785 10.94 3526 7038 27.3 54.6 22.3% 0.0% 0.0% 0.0% 10.91sec 2940253 299.51sec
unbound force unbound force moonfire ticks -8921 2705000 9017 133.31 3326 6629 27.3 666.5 22.2% 0.0% 0.0% 0.0% 10.91sec 2940253 299.51sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
unbound force unbound force solar_wrath 190984 857609 2863 16.06 8778 17492 79.5 80.2 22.0% 0.0% 0.0% 0.0% 3.68sec 857609 299.51sec
unbound force unbound force solar_empowerment 279729 1788298 5971 44.78 8001 0 74.5 223.5 0.0% 0.0% 0.0% 0.0% 3.90sec 1788298 299.51sec
unbound force unbound force starsurge 78674 4116911 13746 11.97 56306 112194 60.0 59.8 22.5% 0.0% 0.0% 0.0% 5.01sec 4116911 299.51sec
unbound force unbound force streaking_stars 272873 1796821 5999 18.05 16390 32798 90.1 90.1 21.7% 0.0% 0.0% 0.0% 3.08sec 1796821 299.51sec
unbound force unbound force sunfire 93402 99950 334 3.63 4508 9011 18.1 18.1 22.2% 0.0% 0.0% 0.0% 16.75sec 2757364 299.51sec
unbound force unbound force sunfire ticks -93402 2657414 8858 133.98 3248 6475 18.1 669.9 22.3% 0.0% 0.0% 0.0% 16.75sec 2757364 299.51sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 213.93sec 0 299.51sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 147.56sec 0 299.51sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
visions visions fury_of_elune 202770 747108 2494 76.64 1649 3290 5.3 382.6 18.5% 0.0% 0.0% 0.0% 60.89sec 747108 299.51sec
visions visions heed_my_call 271685 90652 303 1.66 9228 18443 8.3 8.3 18.8% 0.0% 0.0% 0.0% 33.00sec 90652 299.51sec
visions visions heed_my_call_aoe 271686 116363 389 4.97 3954 7913 8.3 24.8 18.6% 0.0% 0.0% 0.0% 33.00sec 116363 299.51sec
visions visions lunar_strike 194153 3005544 10035 50.06 10138 20241 83.3 249.9 18.7% 0.0% 0.0% 0.0% 3.55sec 3005544 299.51sec
visions visions moonfire 8921 232282 776 10.95 3583 7165 27.3 54.7 18.6% 0.0% 0.0% 0.0% 10.90sec 2902608 299.51sec
visions visions moonfire ticks -8921 2670326 8901 133.37 3376 6747 27.3 666.9 18.6% 0.0% 0.0% 0.0% 10.90sec 2902608 299.51sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
visions visions solar_wrath 190984 865661 2890 16.37 8924 17851 81.1 81.7 18.7% 0.0% 0.0% 0.0% 3.61sec 865661 299.51sec
visions visions solar_empowerment 279729 1768835 5906 44.87 7898 0 74.7 224.0 0.0% 0.0% 0.0% 0.0% 3.90sec 1768835 299.51sec
visions visions starsurge 78674 4059680 13555 12.03 56976 113861 60.3 60.0 18.7% 0.0% 0.0% 0.0% 4.99sec 4059680 299.51sec
visions visions streaking_stars 272873 1929893 6444 19.68 16560 33123 98.2 98.2 18.6% 0.0% 0.0% 0.0% 2.87sec 1929893 299.51sec
visions visions sunfire 93402 98234 328 3.62 4567 9126 18.1 18.1 18.9% 0.0% 0.0% 0.0% 16.78sec 2720539 299.51sec
visions visions sunfire ticks -93402 2622304 8741 134.05 3297 6590 18.1 670.2 18.7% 0.0% 0.0% 0.0% 16.78sec 2720539 299.51sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.43sec 0 299.51sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.26sec 0 299.51sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
worldvein worldvein fury_of_elune 202770 822577 2746 77.75 1789 3574 5.3 388.1 18.5% 0.0% 0.0% 0.0% 60.78sec 822577 299.51sec
worldvein worldvein heed_my_call 271685 88526 296 1.64 9134 18264 8.2 8.2 18.6% 0.0% 0.0% 0.0% 32.87sec 88526 299.51sec
worldvein worldvein heed_my_call_aoe 271686 114200 381 4.91 3914 7831 8.2 24.5 19.0% 0.0% 0.0% 0.0% 32.87sec 114200 299.51sec
worldvein worldvein lunar_strike 194153 3205173 10702 50.93 10622 21251 84.8 254.3 18.7% 0.0% 0.0% 0.0% 3.49sec 3205173 299.51sec
worldvein worldvein moonfire 8921 244925 818 10.94 3777 7559 27.3 54.6 18.7% 0.0% 0.0% 0.0% 10.91sec 3068012 299.51sec
worldvein worldvein moonfire ticks -8921 2823087 9410 133.29 3568 7132 27.3 666.4 18.7% 0.0% 0.0% 0.0% 10.91sec 3068012 299.51sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.51sec
worldvein worldvein solar_wrath 190984 896671 2994 16.08 9411 18822 79.6 80.3 18.7% 0.0% 0.0% 0.0% 3.66sec 896671 299.51sec
worldvein worldvein solar_empowerment 279729 1869339 6241 44.82 8354 0 74.6 223.8 0.0% 0.0% 0.0% 0.0% 3.89sec 1869339 299.51sec
worldvein worldvein starsurge 78674 4249968 14190 11.97 60005 119942 60.0 59.8 18.5% 0.0% 0.0% 0.0% 5.01sec 4249968 299.51sec
worldvein worldvein streaking_stars 272873 1751817 5849 18.05 16394 32795 90.1 90.1 18.6% 0.0% 0.0% 0.0% 3.08sec 1751817 299.51sec
worldvein worldvein sunfire 93402 104193 348 3.63 4827 9665 18.1 18.1 19.0% 0.0% 0.0% 0.0% 16.72sec 2874590 299.51sec
worldvein worldvein sunfire ticks -93402 2770397 9235 133.96 3483 6966 18.1 669.8 18.7% 0.0% 0.0% 0.0% 16.72sec 2874590 299.51sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
393501.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.64% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.32% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.43% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.85% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.91% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.91%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 5.6 0.7 46.2sec 39.8sec 11.89% 0.00% 0.7(0.7) 5.5

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:11.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 393501.40
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 2990
Mean 420597.05
Minimum 398874.60
Maximum 443458.87
Spread ( max - min ) 44584.27
Range [ ( max - min ) / 2 * 100% ] 5.30%
Standard Deviation 8254.3111
5th Percentile 407650.37
95th Percentile 433636.67
( 95th Percentile - 5th Percentile ) 25986.30
Mean Distribution
Standard Deviation 150.9542
95.00% Confidence Intervall ( 420301.18 - 420892.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1480
0.1 Scale Factor Error with Delta=300 581629
0.05 Scale Factor Error with Delta=300 2326513
0.01 Scale Factor Error with Delta=300 58162805
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 669
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 117091112 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
117646.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 12.53% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.56% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.65% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.65%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.03% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.31% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.85% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.64% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.43% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 3.1 0.3 51.1sec 45.1sec 6.56% 0.00% 0.3(0.3) 3.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource RPS-Gain RPS-Loss
Health 0.00 117646.88
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy2 Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data enemy2 Damage Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy2 Priority Target Damage Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy2 Damage Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy2 Damage
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy2 Damage Taken Per Second
Count 2990
Mean 125623.55
Minimum 121185.13
Maximum 130688.76
Spread ( max - min ) 9503.63
Range [ ( max - min ) / 2 * 100% ] 3.78%
Standard Deviation 1696.6337
5th Percentile 122870.28
95th Percentile 128368.03
( 95th Percentile - 5th Percentile ) 5497.75
Mean Distribution
Standard Deviation 31.0279
95.00% Confidence Intervall ( 125562.74 - 125684.37 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 701
0.1 Scale Factor Error with Delta=300 24574
0.05 Scale Factor Error with Delta=300 98293
0.01 Scale Factor Error with Delta=300 2457310
HPS
Sample Data enemy2 Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy2 Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy2 Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy2 Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy2 Theck-Meloree Index
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy2Theck-Meloree Index (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy2 Max Spike Value
Count 669
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 40766244 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
118670.3 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 12.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.57% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.53% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.08% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.24% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.84% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.58% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.54% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.44% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 6.0 0.9 42.2sec 36.0sec 12.71% 0.00% 0.9(0.9) 5.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:12.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy3
Resource RPS-Gain RPS-Loss
Health 0.00 118670.29
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy3 Fight Length
Count 2990
Mean 299.51
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data enemy3 Damage Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy3 Priority Target Damage Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy3 Damage Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy3 Damage
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy3 Damage Taken Per Second
Count 2990
Mean 126816.46
Minimum 121676.61
Maximum 131727.30
Spread ( max - min ) 10050.69
Range [ ( max - min ) / 2 * 100% ] 3.96%
Standard Deviation 1710.7114
5th Percentile 124010.57
95th Percentile 129564.40
( 95th Percentile - 5th Percentile ) 5553.83
Mean Distribution
Standard Deviation 31.2854
95.00% Confidence Intervall ( 126755.14 - 126877.78 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 700
0.1 Scale Factor Error with Delta=300 24983
0.05 Scale Factor Error with Delta=300 99931
0.01 Scale Factor Error with Delta=300 2498258
HPS
Sample Data enemy3 Healing Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy3 Healing Per Second (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy3 Heal
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy3 Healing Taken Per Second
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy3 Theck-Meloree Index
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy3Theck-Meloree Index (Effective)
Count 2990
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy3 Max Spike Value
Count 669
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 36018031 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n